Thesemaphorin family containing 1 Ig-like C2-type domain, 1 PSI domain and 1 Sema domai,Semaphorin-4D, A8, BB18, GR3, SEMA4D, C9orf164, CD100, SEMAJ.
现货供应,欢迎订购: :
CD100 Human Recombinant HEK |
|
||||||||||||
Catalogue Number | PRO-1640 | ||||||||||||
Synonyms | Thesemaphorin family containing 1 Ig-like C2-type domain, 1 PSI domain and 1 Sema domai,Semaphorin-4D, A8, BB18, GR3, SEMA4D, C9orf164, CD100, SEMAJ. | ||||||||||||
Introduction | Semaphorin-4D (CD100) is a member of the semaphorin family containing 1 Ig-like C2-type domain, 1 PSI domain and 1 Sema domain. CD100 is the cell surface receptor forPLXN1B and PLXNB2 which plays a central role in cell-cell signaling. CD100 stimulates the migration of cerebellar granule cells and of endothelial cells, regulates dendrite and axon branching and morphogenesis. In addition, CD100 has a role in the immune system; it promotes signaling via SRC and PTK2B/PYK2, which subsequently mediates activation of phosphatidylinositol 3-kinase and of the AKT1 signaling cascade. | ||||||||||||
Description | CD100 Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 721 amino acids (22-734). CD100 is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques. | ||||||||||||
Source | HEK293 cells. | ||||||||||||
Physical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. | ||||||||||||
Formulation | CD100 was lyophilized from a 0.2 µM filtered solution of 20mM PB and 150mM NaCl, PH 7.4. | ||||||||||||
Solubility | It is recommended to reconstitute the lyophilized CCD100 in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | ||||||||||||
Stability | Lyophilized CD100 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CD100 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles. |
||||||||||||
Purity | Greater than 95% as determined by SDS-PAGE. | ||||||||||||
Amino acid sequence | MAFAPIPRITWEHREVHLVQFHEPDIYNYSALLLSEDKDTLYIGAREAVFAVNALNISEKQHE VYWKVSEDKKAKCAEKGKSKQTECLNYIRVLQPLSATSLYVCGTNAFQPACDHLNLTSFKFLG KNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYNFLGSEPIISRNSSHSPLRTEYAIPWLNEPSF VFADVIRKSPDSPDGEDDRVYFFFTEVSVEYEFVFRVLIPRIARVCKGDQGGLRTLQKKWTSFL KARLICSRPDSGLVFNVLRDVFVLRSPGLKVPVFYALFTPQLNNVGLSAVCAYNLSTAEEVFSH GKYMQSTTVEQSHTKWVRYNGPVPKPRPGACIDSEARAANYTSSLNLPDKTLQFVKDHPLMDDSV TPIDNRPRLIKKDVNYTQIVVDRTQALDGTVYDVMFVSTDRGALHKAISLEHAVHIIEETQLFQD FEPVQTLLLSSKKGNRFVYAGSNSGVVQAPLAFCGKHGTCEDCVLARDPYCAWSPPTATCVALHQ TESPSRGLIQEMSGDASVCPDKSKGSYRQHFFKHGGTAELKCSQKSNSEKTMYLKSSDNRVDHHHHHH. |
||||||||||||
Usage |
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals |
Related Products
ABI3 pro-1227 Recombinant Human ABI Family, Member 3
A2LD1 pro-172 Recombinant Human AIG2-Like Domain 1
A2M pro-551 Human Alpha-2 Macroglobulin Protein
ACTA2 pro-1220 Recombinant Human Actin, Alpha 2, Smooth Muscle, Aorta
ACTG1 pro-377 Recombinant Human Actin Gamma 1
Actin pro-517 Actin
ACTL6A pro-379 Recombinant Human Actin-Like 6A
ADAM10 pro-476 Recombinant Human A Disintegrin and Metalloproteinase Domain 10
ADAM12 pro-474 Recombinant Human A Disintegrin and Metalloproteinase Domain 12 S Isoform
ADFP pro-405 Recombinant Human Adipose Differentiation-Related Protein
Adipsin pro-1360 Recombinant Human Complement Factor D
ADRM1 pro-1079 Recombinant Human Adhesion Regulating Molecule 1
AES pro-169 Recombinant Human Amino-Terminal Enhancer of Split
AFP pro-406 Human Alpha Fetoprotein
Ag85A pro-1076 Recombinant Mycobacterium Tuberculosis major secretory protein Antigen 85A
Ag85B pro-589 Recombinant Mycobacterium Tuberculosis major secretory protein Antigen 85B
AGR2 pro-580 Recombinant Human Anterior Gradient Protein 2 Homolog
AGR3 pro-242 Recombinant Human Anterior Gradient Protein 3 Homolog
AHSP pro-720 Recombinant Human Alpha Hemoglobin Stabilizing Protein
AIDA pro-1370 Recombinant Human Axin Interactor Dorsalization Associated
AIP pro-886 Recombinant Human Aryl Hydrocarbon Receptor Interacting Protein
ALK/P80 pro-455 Recombinant Human ALK-P80
Alpha Actinin pro-518 Alpha Actinin
AMBP pro-407 Human Alpha-1 Microglobulin
AMBP pro-957 Recombinant Human Alpha-1 Microglobulin
AMELX pro-1324 Recombinant Human Amelogenin, X-Linked
AMN pro-1330 Recombinant Human Amnion Associated Transmembrane Protein
AMTN pro-1301 Recombinant Human Amelotin
ANAPC13 pro-1037 Recombinant Human Anaphase Promoting Complex Subunit 13
Angiostatin K1-3 pro-284 Recombinant Human Angiostatin Kringles 1-3
Angiostatin K1-4 pro-604 Human Angiostatin Kringles 1-4
ANKRD1 pro-1219 Recombinant Human Ankyrin Repeat Domain 1
ANP32A pro-252 Recombinant Human Acidic Nuclear Phosphoprotein 32 Family, Member A
ANXA1 pro-679 Recombinant Human Annexin A1
ANXA10 pro-1045 Recombinant Human Annexin A10
ANXA11 pro-278 Recombinant Human Annexin A11
ANXA13 pro-197 Recombinant Human Annexin A13
ANXA2 pro-777 Recombinant Human Annexin A2
ANXA3 pro-765 Recombinant Human Annexin A3
ANXA4 pro-766 Recombinant Human Annexin A4
ANXA5 pro-732 Recombinant Human Annexin A5
ANXA5 Sf9 pro-137 Recombinant Human Annexin A5, Sf9
ANXA6 pro-767 Recombinant Human Annexin A6
ANXA7 pro-449 Recombinant Human Annexin A7
ANXA8 pro-548 Recombinant Human Annexin A8
ANXA8L2 pro-1138 Recombinant Human Annexin A8 Like-2
ANXA9 pro-450 Recombinant Human Annexin A9
AP1S2 pro-234 Recombinant Human Adaptor-Related Protein Complex 1, Sigma 2
AP2M1 pro-451 Recombinant Human Assembly Protein Complex 2
AP3S1 pro-1280 Recombinant Human Assembly Protein Complex 3 Subunit-1
AP3S2 pro-452 Recombinant Human Assembly Protein Complex 3 Subunit-2
APCS pro-453 Recombinant Human Amyloid P Component
APIP pro-1186 Recombinant Human APAF1 interacting protein
Apo Transferrin pro-325 Human Apo Transferrin
APP pro-1080 Recombinant Human Amyloid beta (A4) Precursor Protein
bApo Transferrin pro-511 Bovine Apo Transferrin
bAprotinin pro-285 Bovine Aprotinin
bAprotinin pro-414 Recombinant Bovine Aprotinin
APTX pro-790 Recombinant Human Aprataxin
ARC pro-1403 Recombinant Human Activity-Regulated Cytoskeleton-Associated Protein
ARF1 pro-867 Recombinant Human ADP-Ribosylation Factor 1
ARF3 pro-933 Recombinant Human ADP-Ribosylation Factor 3
ARF4 pro-066 Recombinant Human ADP-Ribosylation Factor 4
ARF5 pro-245 Recombinant Human ADP-Ribosylation Factor 5
ARF6 pro-032 Recombinant Human ADP-Ribosylation Factor 6
ARFIP2 pro-1201 Recombinant Human ADP-Ribosylation Factor Interacting Protein 2
ARHGDIA pro-002 Recombinant Human Rho GDP Dissociation Inhibitor (GDI) Alpha
ARHGDIB pro-1067 Recombinant Human Rho GDP Dissociation Inhibitor (GDI) Beta
ARL1 pro-508 Recombinant Human ADP-Ribosylation Factor-Like 1
ARL11 pro-884 Recombinant Human ADP-Ribosylation Factor-Like 11
ARL14 pro-936 Recombinant Human ADP-Ribosylation Factor-Like 14
ARL15 pro-956 Recombinant Human ADP-Ribosylation Factor-Like 15
ARL2 pro-074 Recombinant Human ADP-Ribosylation Factor-Like 2
ARL2BP pro-274 Recombinant Human ADP-Ribosylation Factor-Like 2 Binding Protein
ARL3 pro-939 Recombinant Human ADP-Ribosylation Factor-Like 3
ARL4A pro-895 Recombinant Human ADP-Ribosylation Factor-Like 4A
ARL4D pro-953 Recombinant Human ADP-Ribosylation Factor-Like 4D
ARL5A pro-040 Recombinant Human ADP-Ribosylation Factor-Like 5A
ARL5B pro-897 Recombinant Human ADP-Ribosylation Factor-Like 5B
ARL6 pro-232 Recombinant Human ADP-Ribosylation Factor-Like 6
ARL9 pro-1009 Recombinant Human ADP-Ribosylation Factor-Like 9
ARPC2 pro-1398 Recombinant Human Actin Related Protein 2/3 Complex, Subunit 2
ARPC5 pro-145 Recombinant Human Actin Related Protein 2/3 Complex, Subunit 5
ARPC3 pro-1413 Recombinant Human Actin Related Protein 2/3 Complex, Subunit 3
ASF1A pro-682 Recombinant Human ASF1 Anti-Silencing Function 1 Homolog A
ASF1B pro-1163 Recombinant Human ASF1 Anti-Silencing Function 1 Homolog B
ASGR2 pro-1261 Recombinant Human Asialoglycoprotein Receptor 2
ASNA1 pro-1247 Recombinant Human arsA Arsenite Transporter, ATP-Binding, Homolog 1
ATG10 pro-1234 Recombinant Human Autophagy Related 10
ATG4B pro-1048 Recombinant Human ATG4 Autophagy Related 4 Homolog B
ATG5 pro-454 Recombinant Human Autophagy Related 5
ATOH1 pro-1073 Recombinant Human Atonal Homolog 1
ATOX1 pro-754 Recombinant Human Copper Transport Protein ATOX1
ATPIF1 pro-1154 Recombinant Human ATPase Inhibitory Factor 1
ATXN3 pro-708 Recombinant Human Ataxin-3
Avidin pro-500 Avidin
Avidin-Biotin pro-446 Modified Affinity Purified Avidin
B2GP1 pro-388 Recombinant Human Beta 2 Glycoprotein-I
B2GP1 pro-552 Human Beta 2 Glycoprotein-I
B2M pro-337 Recombinant Human Beta 2 Microglobulin
B2M pro-553 Human Beta 2 Microglobulin
B2M His pro-859 Recombinant Human Beta 2 Microglobulin, His Tag
BAALC pro-758 Recombinant Human Brain and Acute Leukemia, Cytoplasmatic
BAD pro-458 Recombinant Human BAD
BAG1 pro-817 Recombinant Human BCL2-Associated Athanogene 1
BAG2 pro-168 Recombinant Human BCL2-Associated Athanogene 2
BAG3 pro-760 Recombinant Human BCL2-Associated Athanogene 3
BAIAP2 pro-1022 Recombinant Human BAI1-Associated Protein 2
BASP1 pro-1355 Recombinant Human Brain Abundant Membrane Attached Signal Protein 1
BATF pro-119 Recombinant Human Basic Leucine Zipper Transcription Factor
Batroxobin pro-607 Recombinant Batroxobin
mBAX pro-412 Recombinant Mouse Bax
mBAX GST pro-647 Recombinant Mouse Bax GST Tag
bCAPN2 pro-330 Bovine Calpain-2 Catalytic Subunit
BCAS2 pro-116 Recombinant Human Breast Carcinoma Amplified Sequence 2
BCDIN3D pro-1262 Recombinant Human BCDIN3D
BCL10 pro-1058 Recombinant Human B-cell CLL/Lymphoma 10
Bcl-2 pro-630 Recombinant Human B-Cell Leukemia/Lymphoma 2
Bcl-2 -BH1 pro-631 Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH1
Bcl-2 -BH2 pro-632 Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH2
Bcl-2 -BH3 pro-633 Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH3
Bcl-2 -BH4 pro-411 Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH4
BCL2 His pro-683 Recombinant Human B-Cell Lymphoma Protein 2 Alpha, His Tag
Bcl-2 -NWGR pro-634 Recombinant Human B-Cell Leukemia/Lymphoma 2 -NWGR
BCL2A1 pro-1102 Recombinant Human BCL2-Related Protein A1
BCL2L10 pro-1321 Recombinant Human BCL2 Like 10
BCL2L11 pro-1171 Recombinant Human BCL2 Like 11
BCL2L2 pro-768 Recombinant Human BCL2 Like 2
BCL6 pro-460 Recombinant Human B-cell CLL/lymphoma 6
BCL7A pro-1318 Recombinant Human B-cell CLL/lymphoma 7A
Bcl-XL pro-639 Recombinant Human B-Cell Leukemia/Lymphoma XL
Bcl-XL GST pro-640 Recombinant Human B-Cell Leukemia/Lymphoma XL GST Tag
Bcl-XL His pro-641 Recombinant Human B-Cell Leukemia/Lymphoma His Tag
mBcl-XL pro-1362 Recombinant Mouse B-Cell Leukemia/Lymphoma XL
bECGS pro-603 Bovine Endothelial Mitogen
BECN1 pro-1289 Recombinant Human Beclin 1, Autophagy Related
BGN pro-1382 Recombinant Human Biglycan
bFibronectin pro-059 Bovine Fibronectin
bHolo Transferrin pro-510 Bovine Holo Transferrin
BID pro-627 Recombinant Human BH3 Interacting Domain Death Agonist
mBID pro-642 Recombinant Mouse BH3 Interacting Domain Death Agonist
mBID GST pro-643 Recombinant Mouse BH3 Interacting Domain Death Agonist GST
mtBID pro-644 Recombinant Mouse BH3 Interacting Domain Death Agonist p15
BIN1 pro-546 Recombinant Human Bridging Integrator 1
BIRC5 pro-613 Recombinant Human Baculoviral IAP Repeat-Containing 5
BIRC7 pro-612 Recombinant Human Baculoviral IAP Repeat-Containing 7
BIRC7 (1-280) pro-1042 Recombinant Human Baculoviral IAP Repeat-Containing 7 (1-280 a.a.)
Bivalirudin pro-357 Human Bivalirudin
BLNK pro-102 Recombinant Human B-Cell Linker
BLOC1S2 pro-1094 Recombinant Human Biogenesis of Lysosomal Organelles Complex-1, Subunit 2
BMF pro-700 Recombinant Human Bcl2 Modifying Factor, Isoform 3
bNEFM pro-523 Bovine Neurofilament Medium Polypeptide
BOLA1 pro-302 Recombinant Human BolA Homolog 1
BP-1 pro-463 Recombinant Human BP-1
BPI pro-129 Human Bactericidal/Permeability-Increasing Protein
BPIFA1 pro-404 Recombinant Human BPI fold containing family A Member 1
BSA pro-422 Bovine Serum Albumin
bSNRPD pro-998 Bovine Small Nuclear Ribonucleoprotein Polypeptide
BTF3 pro-1333 Recombinant Human Basic Transcription Factor 3
BUB3 pro-023 Recombinant Human BUB3
bThrombin pro-447 Bovine Thrombin
bTROVE2 pro-111 Bovine TROVE Domain Family, Member 2
bTrypsin pro-313 Recombinant Bovine Trypsin
bVimentin pro-525 Bovine Vimentin
C7ORF49 pro-1415 Recombinant Human Chromosome 7 Open Reading Frame 49
C12ORF5 pro-051 Recombinant Human Chromosome 12 Open Reading Frame 5
C14ORF129 pro-193 Recombinant Human Chromosome 14 Open Reading Frame 129
C16ORF53 pro-225 Recombinant Human Chromosome 16 Open Reading Frame 53
C17ORF49 pro-1192 Recombinant Human Chromosome 17 Open Reading Frame 49
C1q pro-554 Human Complement Component C1q
C1QBP pro-636 Recombinant Human Complement Component 1
C1QTNF1 pro-654 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 1
C1QTNF2 pro-133 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 2
C1QTNF3 pro-653 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 3
C1QTNF6 pro-655 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 6
C1QTNF7 pro-514 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 7
C1QTNF8 pro-134 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 8
C1QTNF9 pro-135 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 9
C20ORF20 pro-1000 Recombinant Human Chromosome 20 Open Reading Frame 20
C3c pro-555 Human Complement Component C3c
C4BPB pro-1174 Recombinant Human Complement Component 4 Binding Protein, Beta
C4c pro-556 Human Complement Component C4c
mC5a pro-085 Recombinant Mouse Complement Component C5a
C6ORF108 pro-249 Recombinant Human Chromosome 6 Open Reading Frame 108
C8G pro-947 Recombinant Human Complement Component 8, Gamma
C9ORF103 pro-1025 Recombinant Human Chromosome 9 Open Reading Frame 103
C9ORF95 pro-1116 Recombinant Human Chromosome 9 Open Reading Frame 95
CAB39 pro-857 Recombinant Human Calcium Binding Protein 39
CAB39L pro-020 Recombinant Human Calcium Binding Protein 39 Like
CABP7 pro-211 Recombinant Human Calcium Binding Protein 7
CACYBP pro-831 Recombinant Human Calcyclin Binding Protein
Cadherin-E pro-461 Recombinant Human Cadherin-E
CALB1 pro-721 Recombinant Human Calbindin-1
CALB2 pro-401 Recombinant Human Calbindin-2
mCALB2 pro-290 Recombinant Mouse Calbindin-2
CALM2 pro-618 Recombinant Human Calmodulin-2
CALM2 135 a.a. pro-370 Recombinant Human Calmodulin-2 135 a.a.
CALML3 pro-1323 Recombinant Human Calmodulin Like 3
CALN1 pro-279 Recombinant Human Calnueron-1
CALR pro-813 Recombinant Human Calreticulin
Calumenin pro-696 Recombinant Human Calumenin
CAMP pro-1405 Recombinant Human Cathelicidin Antimicrobial Peptide
CANT1 pro-1010 Recombinant Human Calcium Activated Nucleotidase 1
CANX pro-725 Recombinant Human Calnexin
CAPG pro-759 Recombinant Human Capping Protein Gelsolin-Like
CAPN1 pro-363 Human Calpain-1 Catalytic Subunit
CAPS pro-117 Recombinant Human Calcyphosine
CAPSL pro-185 Recombinant Human Calcyphosine-Like
CARD18 pro-1061 Recombinant Human Caspase Recruitment Domain Family, Member 18
Cardiac Actin pro-519 Cardiac Actin
CARHSP1 pro-257 Recombinant Human Calcium Regulated Heat Stable Protein 1
CASQ2 pro-799 Recombinant Human Calsequestrin
CBFB pro-534 Recombinant Human Core Binding Factor Beta
CBX1 pro-876 Recombinant Human Chromobox Homolog 1
CBX3 pro-1057 Recombinant Human Chromobox Homolog 3
CBX5 pro-1062 Recombinant Human Chromobox Homolog 5
CCDC43 pro-1398 Recombinant Human Coiled-Coil Domain Containing 43
CCDC101 pro-1063 Recombinant Human Coiled-Coil Domain Containing 101
CCND2 pro-1012 Recombinant Human Cyclin D2
CCNG1 pro-1005 Recombinant Human Cyclin G1
CCS pro-251 Recombinant Human Copper Chaperone for Superoxide Dismutase
CD11b pro-472 Recombinant Human CD11b
CD14-CHO pro-536 Recombinant Human CD14 CHO derived
mCD14 pro-537 Recombinant Mouse CD14
CD1B pro-1267 Recombinant Human CD1B
CD2 pro-1337 Recombinant Human CD2
CD2 GST pro-468 Recombinant Human CD2, GST Tag
CD23 pro-470 Recombinant Human CD23
CD226 pro-1353 Recombinant Human CD226
CD244 pro-1173 Recombinant Human CD244
CD247 pro-1335 Recombinant Human CD247
CD27 pro-1213 Recombinant Human CD27
CD274 pro-1103 Recombinant Human CD274
mCD274 pro-1164 Recombinant Mouse CD274
CD300C pro-273 Recombinant Human CD300C
CD30 pro-1369 Recombinant Human CD30
CD3G pro-1392 Recombinant Human CD3 Gamma
CD34 GST pro-292 Recombinant Human CD34 GST Tag
CD34 pro-1363 Recombinant Human CD34
CD3e pro-1317 Recombinant Human CD3e
CD45 pro-482 Recombinant Human CD45
CD46 pro-1414 Recombinant Human CD46
CD56 pro-483 Recombinant Human CD56
CD68 pro-1209 Recombinant Human CD68
CD68, 38 kda pro-293 Recombinant Human CD68, 38kda
CD72 pro-486 Recombinant Human CD72
CD79B pro-1304 Recombinant Human CD79B
CD83 pro-019 Recombinant Human CD83
CD84 pro-1229 Recombinant Human CD84
CD95 His pro-594 Recombinant Human CD95, His Tag
CD99 pro-294 Recombinant Human CD99
CDC26 pro-241 Recombinant Human Cell Division Cycle 26
CDC37 pro-464 Recombinant Human Cell Division Cycle 37
CDC37, His pro-140 Recombinant Human Cell Division Cycle 37, His Tag
CDC42 pro-727 Recombinant Human Cell Division Cycle 42
CDCA8 pro-222 Recombinant Human Cell Division Cycle Associated 8
CDH11 pro-1368 Recombinant Human Cadherin 11
CEA pro-287 Recombinant Human Carcinoembryonic Antigen
CEBP-a pro-433 Recombinant Human CCAAT/enhancer binding protein(C/EBP) Alpha
CEBP-g pro-434 Recombinant Human CCAAT/enhancer binding protein(C/EBP) Gamma
CENPA pro-389 Recombinant Human Centromere Protein-A
CENPB pro-390 Recombinant Human Centromere Protein-B
CENPH pro-966 Recombinant Human Centromere Protein-H
CETN1 pro-1104 Recombinant Human Centrin-1
CETN2 pro-060 Recombinant Human Centrin-2
CETN3 pro-533 Recombinant Human Centrin-3
CFL1 pro-591 Recombinant Human Cofilin-1
CFL2 pro-912 Recombinant Human Cofilin-2
CFLAR pro-920 Recombinant Human CASP8 and FADD-Like Apoptosis Regulator
CHD4 pro-112 Recombinant Human Chromodomain Helicase DNA Binding Protein 4
CHGA pro-692 Recombinant Human Chromogranin A
CHGA GST pro-491 Recombinant Human Chromogranin A GST Tag
CHGA His pro-699 Recombinant Human Chromogranin A His Tag
CHGB pro-824 Recombinant Human Chromogranin B
CHMP1A pro-1308 Recombinant Human Chromatin Modifying Protein 1A
CHMP1B pro-1117 Recombinant Human Charged Multivesicular Body Protein 1B
CHMP2A pro-503 Recombinant Human Chromatin Modifying Protein 2A
CHMP2B pro-877 Recombinant Human Chromatin Modifying Protein 2B
CHMP4A pro-1024 Recombinant Human Chromatin Modifying Protein 4A
CHMP5 pro-1232 Recombinant Human Charged Multivesicular Body Protein 5
CHMP6 pro-1085 Recombinant Human Charged Multivesicular Body Protein 6
CHP1 pro-847 Recombinant Human Calcium Binding Protein P22
CHRAC1 pro-1391 Recombinant Human Chromatin Accessibility Complex 1
CIAO1 pro-1396 Recombinant Human Cytosolic Iron-Sulfur Protein Assembly 1
CIAPIN1 pro-024 Recombinant Human Cytokine Induced Apoptosis Inhibitor 1
CIRBP pro-746 Recombinant Human Cold Inducible RNA Binding Protein
CISD1 pro-1221 Recombinant Human CDGSH Iron Sulfur Domain 1
CITED2 pro-701 Recombinant Human Cbp/p300-Interacting Transactivator 2
CLDN4 pro-203 Recombinant Human Claudin-4
CLEC2B pro-526 Recombinant Human C-type Lectin Domain Family 2, Member B
CLIC1 pro-833 Recombinant Human Chloride Intracellular Channel 1
CLIC2 pro-198 Recombinant Human Chloride Intracellular Channel 2
CLIC4 pro-173 Recombinant Human Chloride Intracellular Channel 4
CLNS1A pro-1277 Recombinant Human Chloride Channel, Nucleotide-Sensitive, 1A
CLTA pro-1144 Recombinant Human Clathrin, Light Chain A
CLTB pro-1172 Recombinant Human Clathrin, Light Chain B
CNBP pro-1371 Recombinant Human Cellular Nucleic Acid Binding Protein
CNN1 pro-1129 Recombinant Human Calponin 1, Basic, Smooth Muscle
CNPY3 pro-1386 Recombinant Human Canopy 3 Homolog
mCNOT7 pro-908 Recombinant Mouse CCR4-NOT Transcription Complex, Subunit 7
CNRIP1 pro-1214 Recombinant Human Cannabinoid Receptor Interacting Protein 1
COL4A3 pro-387 Recombinant Human Collagen Type IV Alpha 3
COL4A3BP pro-837 Recombinant Human Collagen Type IV Alpha 3 Binding Protein
Collagen pro-359 Recombinant Human Like Collagen
Collagen-3 pro-480 Recombinant Human Collagen-3
COMMD1 pro-862 Recombinant Human Copper Metabolism Domain Containing 1
COMMD9 pro-1244 Recombinant Human COMM Domain Containing 9
COMP HEK pro-132 Recombinant Human Cartilage Oligomeric Matrix Protein, HEK
COPS8 pro-983 Recombinant Human COP9 Constitutive Photomorphogenic 8
COPZ1 pro-221 Recombinant Human Coatomer Protein Complex, Subunit Zeta 1
COTL1 pro-064 Recombinant Human Coactosin-Like 1
COX4NB pro-917 Recombinant Human COX4NB
COX5A pro-1331 Recombinant Human Cytochrome C Oxidase Subunit Va
CPLX1 pro-645 Recombinant Human Complexin-1
CPSF4 pro-1406 Recombinant Human Cleavage And Polyadenylation Specific Factor 4
CRABP1 pro-710 Recombinant Human Cellular Retinoic Acid Binding Protein 1
CRABP2 pro-637 Recombinant Human Cellular Retinoic Acid binding Protein 2
CRADD pro-465 Recombinant Human Caspase and RIP Adapter with Death Domain
CRCP pro-919 Recombinant Human CGRP Receptor Component
CREG1 pro-1196 Recombinant Human Cellular Repressor of E1A-Stimulated Genes 1
CRIPT pro-1105 Recombinant Human Cysteine-Rich PDZ-Binding Protein
CRISP1 pro-473 Recombinant Human Cysteine-Rich Secretory Protein 1
CRK pro-275 Recombinant Human V-crk Sarcoma Virus CT10 Oncogene
CRKL pro-063 Recombinant Human V-crk Sarcoma Virus CT10 Oncogene Homolog (Avian)-Like
CRMP-1 pro-493 Recombinant Human Collapsin Response Mediator Protein-1
CRNN pro-797 Recombinant Human Cornulin
CRP pro-335 Recombinant Human C-Reactive Protein
CRP pro-557 Human C-Reactive Protein
CRP (19-224 a.a.) pro-914 Recombinant Human C-Reactive Protein (19-224 a.a.)
CRYGC pro-1095 Recombinant Human Crystallin, Gamma C
CRYGD pro-913 Recombinant Human Crystallin, Gamma D
CRYGN pro-1152 Recombinant Human Crystallin, Gamma N
CRYGS pro-963 Recombinant Human Crystallin, Gamma S
CSN2 pro-1047 Recombinant Human Casein Beta
CSRP2 pro-1096 Recombinant Human Cysteine and Glycine-rich Protein 2
CST1 pro-1006 Recombinant Human Cystatin SN
CST3 pro-656 Recombinant Human Cystatin C
CST3 pro-413 Human Cystatin C
mCST3 pro-597 Recombinant Mouse Cystatin-C
rCST3 pro-438 Recombinant Rat Cystatin C
CST3 Active pro-961 Recombinant Human Cystatin C Active
CST4 pro-1097 Recombinant Human Cystatin 4
CST6 pro-892 Recombinant Human Cystatin E/M
CST9 pro-955 Recombinant Human Cystatin 9
CSTA pro-086 Recombinant Human Cystatin-A
CSTA GST pro-543 Recombinant Human Cystatin-A, GST tag
CSTA His pro-504 Recombinant Human Cystatin-A His Tag
CSTB pro-609 Recombinant Human Cystatin-B
CSTF1 pro-1170 Recombinant Human Cleavage Stimulation Factor 1
CTBP1 pro-796 Recombinant Human C-Terminal Binding Protein 1
CTNNBIP1 pro-850 Recombinant Human Catenin, Beta Interacting Protein 1
CUL1 pro-268 Recombinant Human Cullin-1
CUTA pro-812 Recombinant Human CutA Divalent Cation Tolerance Homolog
CUTC pro-911 Recombinant Human cutC Copper Transporter Homolog
CYB5A pro-910 Recombinant Human Cytochrome B5 Type A
CYB5R3 pro-1026 Recombinant Human Cytochrome B5 Reductase 3
Cyclosporin-A pro-408 Cyclosporin-A
CYGB pro-842 Recombinant Human Cytoglobin
Cys-Protein-G His pro-1238 Recombinant Cys-Protein G His Tag
CYTH2 pro-1248 Recombinant Human Cytohesin 2
D4GDI pro-296 Recombinant Human D4-GDI
DBI pro-832 Recombinant Human Diazepam Binding Inhibitor
DBNDD1 pro-1162 Recombinant Human Dysbindin (Dystrobrevin Binding Protein 1) Domain Containing 1
DBNDD2 pro-1167 Recombinant Human Dysbindin (Dystrobrevin Binding Protein 1) Domain Containing 2
DCAF7 pro-909 Recombinant Human DDB1 and CUL4 Associated Factor 7
dCASQ2 pro-410 Dog Calsequestrin-2
DCUN1D1 pro-078 Recombinant Human DCN1 Defective in Cullin Neddylation 1 Domain Containing 1
DCUN1D2 pro-899 Recombinant Human DCN1 Defective in Cullin Neddylation 1 Domain Containing 2
DDIT3 pro-638 Recombinant Human DNA Damage Inducible Transcript 3
DDIT4 pro-094 Recombinant Human DNA Damage Inducible Transcript 4
DEDD pro-1349 Recombinant Human Death Effector Domain Containing
DENR pro-926 Recombinant Human Density-Regulated Protein
Desmin pro-520 Recombinant Human Desmin
DFFA pro-718 Recombinant Human DNA Fragmentation Factor Subunit Alpha
DGCR6 pro-1372 Recombinant Human DiGeorge Syndrome Critical Region Gene 6
DIRAS1 pro-256 Recombinant Human DIRAS family, GTP-binding RAS-like 1
DKK1 pro-673 Recombinant Human Dickkopf-Related Protein 1
DKK1 HEK pro-815 Recombinant Human Dickkopf-Related Protein 1 HEK
DKK2 pro-1205 Recombinant Human Dickkopf-Related Protein 2
DKK3 pro-1175 Recombinant Human Dickkopf-Related Protein 3
DNAL1 pro-1357 Recombinant Human Dynein Axonemal Light Chain 1
DNAL4 pro-227 Recombinant Human Dynein Axonemal Light Chain 4
DPPA3 pro-1291 Recombinant Human Developmental Pluripotency Associated 3
DR1 pro-542 Recombinant Human Down-Regulator of Transcription 1
DRG1 pro-885 Recombinant Human Developmentally Regulated GTP Binding Protein 1
DSTN pro-1137 Recombinant Human Destrin
DTNBP1 pro-675 Recombinant Human Dystrobrevin-Binding Protein 1 Isoform C
DYNLL1 pro-262 Recombinant Human Dynein Light Chain LC8 Type-1
DYNLL2 pro-235 Recombinant Human Dynein Light Chain LC8 Type-2
DYNLRB1 pro-489 Recombinant Human Dynein Light Chain Roadblock-Type 1
DYNLRB2 pro-174 Recombinant Human Dynein Light Chain Roadblock-Type 2
DYNLT1 pro-757 Recombinant Human Dynein, Light Chain, Tctex-Type 1
DYNLT3 pro-1197 Recombinant Human Dynein, Light Chain, Tctex-Type 3
EBAG9 pro-343 Recombinant Human Estrogen Receptor Binding Site Associated Antigen 9
ECSIT pro-1241 Recombinant Human ECSIT homolog
EDF1 pro-494 Recombinant Human Endothelial Differentiation-Related Factor 1
EEF1B2 pro-167 Recombinant Human Eukaryotic Translation Elongation Factor 1 Beta 2
EEF1D pro-170 Recombinant Human Eukaryotic Translation Elongation Factor 1 Delta
EEF1E1 pro-199 Recombinant Human Eukaryotic Translation Elongation Factor 1 Epsilon 1
EFNA1 pro-971 Recombinant Human Ephrin A1
EFNA4 pro-498 Recombinant Human Ephrin A4
EFNB1 pro-918 Recombinant Human Ephrin- B1
EFNB2 pro-937 Recombinant Human Ephrin- B2
EFNB3 pro-1169 Recombinant Human Ephrin- B3
EGLN3 pro-1143 Recombinant Human Egl Nine Homolog 3
EIF1 pro-773 Recombinant Human Eukaryotic Translation Initiation Factor 1
EIF1AX pro-253 Recombinant Human Eukaryotic Translation Initiation Factor 1A X-linked
EIF1AY pro-098 Recombinant Human Eukaryotic Translation Initiation Factor 1A Y-linked
EIF1B pro-175 Recombinant Human Eukaryotic Translation Initiation Factor 1B
EIF2B1 pro-209 Recombinant Human Eukaryotic Translation Initiation Factor 2B Subunit 1 Alpha
EIF2S1 pro-845 Recombinant Human Eukaryotic Translation Initiation Factor 2 Subunit 1 Alpha
EIF3J pro-970 Recombinant Human Eukaryotic Translation Initiation Factor 3J
EIF3K pro-179 Recombinant Human Eukaryotic Translation Initiation Factor 3K
EIF4A3 pro-1007 Recombinant Human Eukaryotic Translation Initiation Factor 4A3
EIF4E pro-530 Recombinant Human Eukaryotic Translation Initiation Factor 4E
EIF4EBP1 pro-532 Recombinant Human Eukaryotic Translation Initiation Factor 4E-Binding Protein 1
EIF4EBP2 pro-176 Recombinant Human Eukaryotic Translation Initiation Factor 4E-Binding Protein 2
EIF4H pro-1114 Recombinant Human Eukaryotic Translation Initiation Factor 4H
EIF5A pro-674 Recombinant Human Eukaryotic Translation Initiation Factor 5A
EIF5A2 pro-846 Recombinant Human Eukaryotic Translation Initiation Factor 5A2
Eledoisin pro-281 Eledoisin
EMCN pro-1156 Recombinant Human Endomucin
EMG1 pro-1122 Recombinant Human EMG1 Nucleolar Protein
Endostatin pro-248 Recombinant Human Endostatin
Enfuvirtide pro-376 Enfuvirtide T-20
ENSA pro-772 Recombinant Human Endosulfine Alpha
EPCAM pro-1322 Recombinant Human Epithelial Cell Adhesion Molecule
Eptifibatide pro-358 Human Eptifibatide
ER-a pro-499 Recombinant Human Estrogen Receptor Alpha
ERCC1 pro-1106 Recombinant Human Excision Repair Cross-Complementing 1
ERCC1, GST pro-496 Recombinant Human Excision Repair Cross-Complementing 1, GST Tag
ERH pro-121 Recombinant Human Enhancer of Rudimentary
ERLIN2 pro-1266 Recombinant Human ER Lipid Raft Associated 2
ERP27 pro-046 Recombinant Human Endoplasmic Reticulum Protein 27
ERP44 pro-547 Recombinant Human Endoplasmic Reticulum Protein 44
ESAT6 pro-291 Recombinant Early Secretory Target Mycobacterium Tuberculosis
E-Selectin pro-380 Recombinant Human E-Selectin
ESM1 pro-1328 Recombinant Human Endothelial Cell-Specific Molecule 1
ETFB pro-220 Recombinant Human Electron-Transfer-Flavoprotein Beta Polypeptide
ETHE1 pro-1027 Recombinant Human Ethylmalonic Encephalopathy 1
ETS1 pro-501 Recombinant Human C-ets-1 Protein
EXOSC10 pro-444 Recombinant Human Exosome Component 10
EXOSC5 pro-1059 Recombinant Human Exosome Component 5
EXOSC9 pro-126 Recombinant Human Exosome Component 9
EYA2 pro-1071 Recombinant Human Eyes Absent Homolog 2
F11R pro-1112 Recombinant Human F11 Receptor
F3 pro-312 Recombinant Human Coagulation Factor III
F7 pro-331 Recombinant Human Coagulation Factor VIIa
F8 pro-317 Human Coagulation Factor VIII
F8 pro-318 Recombinant Human Coagulation Factor VIII
F9 pro-353 Human Coagulation Factor IX
FABP1 pro-588 Recombinant Human Fatty Acid Binding Protein-1
mFABP1 pro-1121 Recombinant Mouse Fatty Acid Binding Protein-1
FABP12 pro-738 Recombinant Human Fatty Acid Binding Protein-12
FABP2 pro-669 Recombinant Human Fatty Acid Binding Protein-2
FABP3 pro-340 Recombinant Human Fatty Acid Binding Protein-3
FABP3 His pro-668 Recombinant Human Fatty Acid Binding Protein-3, His Tag
FABP4 pro-416 Recombinant Human Fatty Acid Binding Protein-4
FABP4 His pro-566 Recombinant Human Fatty Acid Binding Protein-4, His Tag
FABP5 pro-417 Recombinant Human Fatty Acid Binding Protein-5
FABP5 His pro-666 Recombinant Human Fatty Acid Binding Protein-5, His Tag
FABP6 pro-649 Recombinant Human Fatty Acid Binding Protein-6
FABP6 His pro-667 Recombinant Human Fatty Acid Binding Protein-6, His Tag
FABP7 pro-628 Recombinant Human Fatty Acid Binding Protein-7
FABP7 His pro-661 Recombinant Human Fatty Acid Binding Protein-7, His Tag
FABP9 pro-1088 Recombinant Human Fatty Acid Binding Protein-9
FADD pro-733 Recombinant Human Fas-Associated Death Domain
FAM3B pro-139 Recombinant Human Family with Sequence Similarity 3, Member B
FAM3C pro-952 Recombinant Human Family with Sequence Similarity 3, Member C
FAM49B pro-1411 Recombinant Human Family with Sequence Similarity 49, Member B
FCGR1A pro-1228 Recombinant Human CD64
FCGR2A pro-029 Recombinant Human CD32a
FCGR2B pro-1295 Recombinant Human CD32
FCGR3A pro-1150 Recombinant Human CD16a
FDCSP pro-1339 Recombinant Human Follicular Dendritic Cell Secreted Protein
FDX1 pro-713 Recombinant Human Ferredoxin-1
Ferritin pro-564 Human Liver Ferritin
Ferritin Heavy pro-658 Recombinant Human Ferritin Heavy Chain
Ferritin Light pro-650 Recombinant Human Ferritin Light Chain
Fetuin-A pro-418 Human Alpha-2-HS-Glycoprotein
FHIT pro-828 Recombinant Human Fragile Histidine Triad
FHIT, GST pro-297 Recombinant Human Fragile Histidine Triad, GST Tag
Fibronectin pro-448 Human Fibronectin
Filamin pro-521 Filamin
FIMC pro-120 Recombinant E.Coli Chaperone Protein fimC
FIS1 pro-829 Recombinant Human Fission-1
Flagellin pro-1240 Recombinant Flagellin
FOPNL pro-1195 Recombinant Human FGFR1OP N-terminal like
FOS-B pro-505 Recombinant Human FOS-B
Frataxin pro-761 Recombinant Human Frataxin
FRZB pro-1345 Recombinant Human Frizzled-Related Protein
FSCN1 pro-527 Recombinant Human Fascin
FTSJ2 pro-1207 Recombinant Human FtsJ RNA Methyltransferase Homolog 2
FUBP1 pro-1132 Recombinant Human Far Upstream Element Binding Protein
FUR pro-622 Recombinant E.Coli Ferric Uptake Regulator
FXYD5 pro-1366 Recombinant Human FXYD5
Fyn-p59 pro-506 Recombinant Human Fyn-p59
FZD1 pro-816 Recombinant Human Frizzled-1
GABARAP pro-775 Recombinant Human GABA(A) Receptor-Associated Protein
GABARAPL1 pro-048 Recombinant Human GABA(A) Receptor-Associated Protein Like 1
GABARAPL2 pro-079 Recombinant Human GABA(A) Receptor-Associated Protein Like 2
GADD45A pro-783 Recombinant Human Growth Arrest and DNA-Damage-Inducible Alpha
GADD45B pro-563 Recombinant Human Growth Arrest and DNA-Damage-Inducible Beta
GADD45G pro-570 Recombinant Human Growth Arrest and DNA-Damage-Inducible Gamma
GADD45GIP1 pro-972 Recombinant Human Growth Arrest and DNA-Damage-Inducible Gamma Interacting Protein 1
GAGA-POZ pro-435 Recombinant Drosophila melanogaster GAGA-POZ
GAP43 pro-1126 Recombinant Human Growth Associated Protein 43
GAS7 pro-680 Recombinant Human Growth Arrest-Specific 7, Isoform b
GCA pro-080 Recombinant Human Grancalcin
GCSAM pro-1282 Recombinant Human Germinal Center-Associated, Signaling and Motility
GCSH pro-973 Recombinant Human Glycine Cleavage System Protein H
GCV syn-001 Ganciclovir
Gelatin pro-481 Recombinant Human Gelatin
GEMIN6 pro-1394 Recombinant Human Gem-Associated Protein 6
GFER pro-1326 Recombinant Human Growth Factor, Augmenter of Liver Regeneration
GFP pro-522 Glial Filament Protein
GINS4 pro-1270 Recombinant Human GINS Complex Subunit 4
GIPC1 pro-855 Recombinant Human GIPC PDZ Domain Member 1
GIPC2 pro-1035 Recombinant Human GIPC PDZ Domain Member 2
GKN1 pro-1206 Recombinant Human Gastrokine 1
GLC8 pro-540 Recombinant Yeast GLC8
Gliadin pro-114 Recombinant Wheat Gliadin
GLIPR2 pro-550 Recombinant Human GLI Pathogenesis-Related 2
GLOD4 pro-894 Recombinant Human Glyoxalase Domain Containing 4
GLTP pro-1313 Recombinant Human Glycolipid Transfer Protein
GMNN pro-579 Recombinant Human Geminin
GNAI1 pro-940 Recombinant Human Guanine Nucleotide Binding Protein Alpha Inhibiting Activity 1
GNAI2 pro-1310 Recombinant Human Guanine Nucleotide Binding Protein-G Alpha Inhibiting Activity Polypeptide 2
GNAI3 pro-1074 Recombinant Human Guanine Nucleotide Binding Protein Alpha Inhibiting Activity 3
GNAZ pro-1225 Recombinant Human Guanine Nucleotide Binding Protein Alpha Z Polypeptide
GNB2L1 pro-1023 Recombinant Human Guanine Nucleotide Binding Protein beta polypeptide 2-like 1
GNLY pro-852 Recombinant Human Granulysin
GOPC pro-793 Recombinant Human Golgi-Associated PDZ and Coiled-Coil Motif Containing
GOSR2 pro-1399 Recombinant Human Golgi SNAP Receptor Complex Member 2
GP2 pro-115 Recombinant Human Glycoprotein-2
GP9 pro-055 Recombinant Human Glycoprotein-9
GPN1 pro-1140 Recombinant Human GPN-loop GTPase 1
GRAP2 pro-081 Recombinant Human GRB2-Related Adaptor Protein 2
GRB2 pro-678 Recombinant Human Growth Factor Receptor-Bound Protein 2
GREM1 pro-1359 Recombinant Human GREM1
GRPEL1 pro-263 Recombinant Human GrpE-Like 1
GTF2B pro-762 Recombinant Human General Transcription Factor IIB
GTF2E2 pro-1107 Recombinant Human General Transcription Factor IIE, Polypeptide 2
GTF2F2 pro-1093 Recombinant Human General Transcription Factor IIF, Polypeptide 2
GULP1 pro-1398 Recombinant Human GULP1
HAND1 pro-1231 Recombinant Human Heart and Neural Crest Derivatives Expressed 1
Haptoglobin pro-567 Recombinant Human Haptoglobin
Haptoglobin pro-558 Human Haptoglobin
HAUS1 pro-1077 Recombinant Human HAUS Augmin-Like Complex, Subunit 1
HAX1 pro-1367 Recombinant Human HCLS1 Associated Protein X-1
HbA1c pro-299 Human Hemoglobin A1c
HBA2 pro-1183 Recombinant Human Hemoglobin, Alpha 2
HBG2 pro-021 Recombinant Human Hemoglobin Gamma G
HBZ pro-803 Recombinant Human Hemoglobin-Zeta
HDL pro-559 Human High Density Lipoprotein
HEBP1 pro-1316 Recombinant Human Heme Binding Protein 1
Hemopexin pro-560 Human Hemopexin
HES7 pro-1306 Recombinant Human Hairy and Enhancer of Split 7
HEXIM1 pro-789 Recombinant Human Hexamethylene Bis-Acetamide Inducible 1
HFE pro-1332 Recombinant Human Hemochromatosis
HIF1A pro-477 Recombinant Human Hypoxia-Inducible Factor-1 Alpha
HIF1A (85 a.a.) pro-258 Recombinant Human Hypoxia-Inducible Factor-1 Alpha (85 a.a.)
HIF1A His pro-415 Recombinant Human Hypoxia-Inducible Factor-1 Alpha His Tag
HIF1AN pro-662 Recombinant Human Hypoxia-Inducible Factor-1 Alpha Inhibitor
HINT1 pro-702 Recombinant Human Histidine Triad Nucleotide Binding Protein 1
Hirudin pro-362 Recombinant Hirudin
HLF pro-904 Recombinant Human Hepatic Leukemia Factor
HMGA1 pro-887 Recombinant Human High Mobility Group AT-Hook 1
HMGB1 pro-581 Recombinant Human High-Mobility Group Box 1
HMGB1 Hi-5 pro-610 Recombinant Human High-Mobility Group Box 1 Hi-5 Insect Cells
HMGB2 pro-888 Recombinant Human High-Mobility Group Box 2
HMGN1 pro-821 Recombinant Human High-Mobility Group Nucleosome Binding Domain 1
HN1L pro-027 Recombinant Human Hematological and Neurological Expressed 1-Like
HNRNPA1 pro-1038 Recombinant Human Heterogeneous Nuclear Ribonucleoprotein A1
HNRNPC pro-177 Recombinant Human Heterogeneous Nuclear Ribonucleoprotein C
Holo Transferrin pro-315 Human Holo Transferrin
HOMER1 pro-695 Recombinant Human Homer Homolog-1
HOMER2 pro-1072 Recombinant Human Homer Homolog-2
HOMER3 pro-1108 Recombinant Human Homer Homolog-3
HOPX pro-1158 Recombinant Human HOP homeobox
HPCAL1 pro-254 Recombinant Human Hippocalcin-Like 1
HPG1 pro-423 Recombinant Human Prostate Specific Gene-1
HRAS pro-822 Recombinant Human V-Ha-ras Harvey Rat Sarcoma Viral Oncogene Homolog
HRSP12 pro-052 Recombinant Human Heat-Responsive Protein 12
HSA pro-354 Human Serum Albumin
HSCB pro-1142 Recombinant Human HscB Iron-Sulfur Cluster Co-Chaperone
HSD17B10 pro-823 Recombinant Human Hydroxysteroid (17-beta) Dehydrogenase 10
HUS1 pro-039 Recombinant Human HUS1 Checkpoint Homolog
ICAM-1 pro-383 Recombinant Human Intercellular Adhesion Molecule-1
ICT1 pro-1303 Recombinant Human Immature Colon Carcinoma Transcript 1
ID2 pro-1383 Recombinant Human Inhibitor of DNA Binding 2
IFT20 pro-1222 Recombinant Human Intraflagellar Transport 20 Homolog
IGLL1 pro-1390 Recombinant Human Immunoglobulin Lambda-Like Polypeptide 1
IGJ pro-1416 Recombinant Human Immunoglobulin J
IMP3 pro-015 Recombinant Human IMP3
IMPAD1 pro-1346 Recombinant Human Inositol Monophosphatase Domain Containing 1
mIgG pro-1087 Recombinant Mouse Immunoglobulin Heavy Chain Constant Region Gamma 2a
mIgG His pro-1086 Recombinant Mouse Immunoglobulin Heavy Chain Constant Region Gamma 2a, His Tag
Intein pro-958 Recombinant Bacillus Circulans Intein
Internalin pro-031 Recombinant Listeria Monocytogenes Internalin
Intrinsic Factor pro-375 Recombinant Human Intrinsic Factor
Involucrin pro-512 Recombinant Human Involucrin
IPP-POZ pro-436 Recombinant Human IPP-POZ
IRGM pro-1302 Recombinant Human Immunity-Related GTPase Family, M
ISCU pro-072 Recombinant Human Iron-sulfur Cluster Scaffold Homolog
ISG15 pro-611 Recombinant Human Interferon Stimulated Gene 15
ITGB1BP3 pro-1177 Recombinant Human Integrin Beta 1 Binding Protein 3
JAM2 pro-1336 Recombinant Human Junctional Adhesion Molecule 2
JAM3 pro-1223 Recombinant Human Junctional Adhesion Molecule 3
JOSD1 pro-1251 Recombinant Human Josephin Domain Containing 1
k9Cystatin-C pro-138 Recombinant Canine Cystatin-C
KAAG1 pro-192 Recombinant Human Kidney Associated Antigen 1
KCNIP3 pro-009 Recombinant Human Kv Channel Interacting Protein 3
KCTD5 pro-1276 Recombinant Human Potassium Channel Tetramerisation Domain Containing 5
KCTD11 pro-1376 Recombinant Human Potassium Channel Tetramerisation Domain Containing 11
KCTD15 pro-1002 Recombinant Human Potassium Channel Tetramerisation Domain Containing 15
KIN pro-1275 Recombinant Human KIN
KIR2DL1 pro-428 Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 2 Domains Long Cytoplasmic Tail 1
KIR2DL3 pro-429 Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 2 Domains Long Cytoplasmic Tail 3
KIR2DS4 pro-430 Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 2 Domains Short Cytoplasmic Tail 4
KIR3DL1 pro-427 Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 3 Domains Long Cytoplasmic Tail 1
KISS1 pro-419 Recombinant Human KISS-1 Metastasis-Suppressor
KLF4 pro-891 Recombinant Human Kruppel-Like Factor 4
KLRB1 pro-1189 Recombinant Human Killer Cell Lectin-Like Receptor Subfamily B, Member 1
KLRC2 pro-1190 Recombinant Human Killer Cell Lectin-Like Receptor Subfamily C, Member 2
KLRC3 pro-1230 Recombinant Human Killer Cell Lectin-Like Receptor Subfamily C, Member 3
KLRG1 pro-1344 Recombinant Human Killer Cell lectin-like Receptor Subfamily G, Member 1
KLRK1 pro-1290 Recombinant Human Killer Cell lectin-Like Receptor Subfamily K, Member 1
KPNA2 pro-1032 Recombinant Human karyopherin Alpha 2
KPNB1 pro-1001 Recombinant Human karyopherin Beta 1
KRAS pro-854 Recombinant Human Kirsten Rat Sarcoma Viral Oncogene
KRT14 pro-348 Recombinant Human Cytokeratin 14
KRT14 His pro-941 Recombinant Human Cytokeratin 14 His Tag
KRT18 pro-349 Recombinant Human Cytokeratin 18
KRT18 His pro-484 Recombinant Human Cytokeratin 18 His Tag
KRT19 pro-350 Recombinant Human Cytokeratin 19
KRT19 His pro-1347 Recombinant Human Cytokeratin 19 His Tag
KRT20 pro-351 Recombinant Human Cytokeratin 20
KRT20 His pro-1358 Recombinant Human Cytokeratin 20 His Tag
KRT8 pro-347 Recombinant Human Cytokeratin 8
KRT8 GST pro-298 Recombinant Human Cytokeratin 8 GST-Tag
Ku P70/P80 pro-397 Recombinant Human Ku P70/P80
LA/SS-B pro-327 Recombinant Human LA / SS-B
LAIR1 pro-431 Recombinant Human Leukocyte-Associated Ig-Like Receptor 1
LAIR2 pro-1081 Recombinant Human Leukocyte-Associated Ig-Like Receptor 2
Lamin-A pro-690 Recombinant Human Lamin-A
LAMP2 pro-130 Recombinant Human Lysosomal-Associated Membrane Protein 2
LASP1 pro-1031 Recombinant Human LIM and SH3 Protein 1
LAT pro-948 Recombinant Human Linker for Activation of T Cells
LBP pro-538 Recombinant Human Lipopolysaccarid Binding Protein
mLBP pro-539 Recombinant Mouse Lipopolysaccarid Binding Protein
LDL pro-562 Low Density Lipoprotein
LDLRAP1 pro-1033 Recombinant Human Low Density Lipoprotein Receptor Adaptor Protein 1
LDOC1L pro-1153 Recombinant Human Leucine Zipper, Down-Regulated in Cancer 1-Like
LEFTY1 pro-962 Recombinant Human Left-Right Determination Factor 1
LGALS10 pro-744 Recombinant Human Charcot-Leyden Crystal Protein
LGALSL pro-1374 Recombinant Human Lectin Galactoside-Binding-Like
LIN28A pro-743 Recombinant Human LIN28
LIN28B pro-1249 Recombinant Human LIN28B
LIN7A pro-1252 Recombinant Human LIN7A
LIN7B pro-1298 Recombinant Human LIN7B
LIN7C pro-1305 Recombinant Human LIN7C
LITAF pro-1350 Recombinant Human Lipopolysaccharide-Induced TNF Factor
LLC pro-561 Human Lambda Light Chain
LLO pro-320 Recombinant Listeriolysin-O
LLO-pest pro-373 Recombinant Listeriolysin-O PEST-free
LRG1 pro-141 Human Leucine-Rich Alpha-2-Glycoprotein 1
LRPAP1 pro-1029 pro-151
L-Selectin pro-381 Recombinant Human L-Selectin
LSM1 pro-259 Recombinant Human LSM1 Homolog, U6 Small Nuclear RNA Associated
LSM12 pro-1329 Recombinant Human LSM12 Homolog, U6 Small Nuclear RNA Associated
LSM2 pro-1069 Recombinant Human LSM2 Homolog, U6 Small Nuclear RNA Associated
LSM3 pro-1060 Recombinant Human LSM3 Homolog, U6 Small Nuclear RNA Associated
LSM4 pro-065 Recombinant Human LSM4 Homolog, U6 Small Nuclear RNA Associated
LTF Holo pro-592 Recombinant Human Lactoferrin Holo
LYG2 pro-1245 Recombinant Human Lysozyme G-Like 2
LYN pro-136 Recombinant Human v-yes-1 Yamaguchi Sarcoma Viral Related Oncogene
M.Pneumoniae pro-795 Recombinant Mycoplasma Pneumoniae P1-N2
M.Pneumoniae pro-801 Recombinant Mycoplasma Pneumoniae P1-C
MAD2L1 pro-934 Recombinant Human MAD2 Mitotic Arrest Deficient-Like 1
MAD2L1BP pro-1052 Recombinant Human MAD2L1 Binding Protein
MAF1 pro-921 Recombinant Human MAF1
MAFG pro-968 Recombinant Human V-maf Musculoaponeurotic Fibrosarcoma Oncogene G
MAFK pro-025 Recombinant Human V-maf Musculoaponeurotic Fibrosarcoma Oncogene K
MAGEA1 pro-311 Recombinant Human Melanoma Antigen Family A, 1
MAGEA3 pro-502 Recombinant Human Melanoma Antigen Family A, 3
MAGEA4 pro-843 Recombinant Human Melanoma Antigen Family A, 4
MAGEA5 pro-1070 Recombinant Human Melanoma Antigen Family A, 5
MAGEA6 pro-1113 Recombinant Human Melanoma Antigen Family A, 6
MAGOH pro-810 Recombinant Human Mago-Nashi Homolog
MAP1LC3A pro-495 Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 Alpha
MAP1LC3B pro-076 Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 Beta
MAP1LC3B2 pro-215 Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 Beta 2
MAPKSP1 pro-034 Recombinant Human MAPK Scaffold Protein 1
MAPRE1 pro-058 Recombinant Human Microtubule-Associated Protein, RP/EB Family, Member 1
MAPRE2 pro-932 Recombinant Human Microtubule-Associated Protein, RP/EB Family, Member 2
MAPRE3 pro-264 Recombinant Human Microtubule-Associated Protein, RP/EB Family, Member 3
MAPT pro-295 Recombinant Human Microtubule-Associated Protein Tau
MAPT 381a.a. pro-042 Recombinant Human Microtubule-Associated Protein Tau 381 a.a.
MAPT 383a.a. pro-012 Recombinant Human Microtubule-Associated Protein Tau 383 a.a.
MAPT 412a.a. pro-210 Recombinant Human Microtubule-Associated Protein Tau 412 a.a.
MAVS pro-1351 Recombinant Human Mitochondrial Antiviral Signaling Protein
MAX pro-811 Recombinant Human MYC Associated Factor X
MBD3 pro-1243 Recombinant Human Methyl-CpG Binding Domain Protein 3
MBL2 pro-1285 Recombinant Human Mannose-Binding Lectin 2
MBP pro-616 Recombinant E.Coli Maltose Binding Protein
MCFD2 pro-769 Recombinant Human Multiple Coagulation Factor Deficiency 2
MCL1 pro-1202 Recombinant Human Myeloid Cell Leukemia Sequence 1
MCTS1 pro-1387 Recombinant Human Malignant T-Cell-Amplified Sequence 1
MECP2 pro-212 Recombinant Human Methyl CpG Binding Protein 2
MED20 pro-1204 Recombinant Human Mediator Complex Subunit 20
MED4 pro-785 Recombinant Human Mediator Complex Subunit 4
MED7 pro-1319 Recombinant Human Mediator Complex Subunit 7
Melanoma pro-509 Recombinant Human Melanoma (gp100)
MEMO1 pro-1148 Recombinant Human Mediator of Cell Motility 1
MESDC2 pro-122 Recombinant Human Mesoderm Development Candidate 2
MET pro-207 Recombinant Human Met Proto-Oncogene
MET, GST pro-497 Recombinant Human Met Proto-Oncogene, GST Tag
MFAP2 pro-1265 Recombinant Human Microfibrillar-associated Protein 2
MFAP4 pro-1210 Recombinant Human Microfibrillar-associated Protein 4
MGP pro-922 Recombinant Human Matrix Gla Protein
MICA pro-367 Recombinant Human MHC class I chain-related gene A
MICB pro-368 Recombinant Human MHC class I chain-related gene B
MIS12 pro-022 Recombinant Human MIS12
MLF1 pro-100 Recombinant Human Myeloid Leukemia Factor 1
MMACHC pro-1119 Recombinant Human Methylmalonic Aciduria cblC type, with Homocystinuria
MNDA pro-763 Recombinant Human Myeloid Cell Nuclear Differentiation Antigen
MOBKL1B pro-068 Recombinant Human MOB1, Mps One Binder Kinase Activator-Like 1B
MOBLK3 pro-049 Recombinant Human MOB1, Mps One Binder Kinase Activator-Like 3
MOCS2 pro-1281 Recombinant Human Molybdenum Cofactor Synthesis 2
MOG pro-371 Myelin Oligodendrocyte Glycoprotein
MOG pro-466 Recombinant Human Myelin Oligodendrocyte Glycoprotein
MORF4L1 pro-1078 Recombinant Human Mortality Factor 4 Like 1
MORF4L2 pro-475 Recombinant Human Mortality Factor 4 Like 2
MRAS pro-1008 Recombinant Human Muscle RAS Oncogene Homolog
MRM1 pro-1416 Recombinant Human Mitochondrial RRNA Methyltransferase 1
MRRF pro-1299 Recombinant Human Mitochondrial Ribosome Recycling Factor
MRTO4 pro-1233 Recombinant Human mRNA Turnover 4
MRPL28 pro-1279 Recombinant Human Mitochondrial Ribosomal Protein L28
MRPL13 pro-1404 Recombinant Human Mitochondrial Ribosomal Protein L13
MSH6 pro-745 Recombinant Human MutS Homolog 6
MXD3 pro-1356 Recombinant Human MAX Dimerization Protein 3
MUTED pro-1155 Recombinant Human MUTED
MYC pro-087 Recombinant Human V-Myc Myelocytomatosis Viral Oncogene
MYCBP pro-942 Recombinant Human C-Myc Binding Protein
MYD88 pro-1377 Recombinant Human Myeloid Differentiation Primary Response 88
MYL1 pro-365 Recombinant Human Myosin Light Chain 1
MYL12A pro-902 Recombinant Human Myosin Light Chain 12A
MYL12B pro-1124 Recombinant Human Myosin Light Chain 12B
MYL2 pro-524 Recombinant Human Myosin Light Chain 2
MYL4 pro-992 Recombinant Human Myosin Light Chain 4
MYL5 pro-916 Recombinant Human Myosin Light Chain 5
MYL5 (1-173 a.a.) pro-943 Recombinant Human Myosin Light Chain 5 (1-173 a.a.)
MYL6 pro-171 Recombinant Human Myosin Light Chain 6
MYL6B pro-964 Recombinant Human Myosin Light Chain 6B
MYL7 pro-1109 Recombinant Human Myosin Light Chain 7
MYL9 pro-107 Recombinant Human Myosin Light Chain 9
MYLPF pro-243 Recombinant Human Myosin Light chain, Phosphorylatable, Fast Skeletal Muscle
Myoglobin pro-336 Recombinant Human Myoglobin
Myoglobin pro-565 Human Myoglobin
Myoglobin heme free pro-374 Recombinant Human Myoglobin Heme free
Myoglobin His pro-071 Recombinant Human Myoglobin, His Tag
NACA pro-974 Recombinant Human Nascent Polypeptide-Associated Complex Alpha
NANOG pro-896 Recombinant Human Nanog
NANOG, His pro-881 Recombinant Human Nanog, His Tag
NANOG-TAT pro-090 Recombinant Human Nanog-TAT
NAP1L1 pro-985 Recombinant Human Nucleosome Assembly Protein 1-Like 1
NAPA pro-250 Recombinant Human N-Ethylmaleimide-Sensitive Factor Attachment Protein, Alpha
NAPG pro-944 Rcombinant Human N-ethylmaleimide-Sensitive Factor Attachment Protein, Gamma
NBL1 pro-1365 Recombinant Human Neuroblastoma 1
NCALD pro-093 Recombinant Human Neurocalcin Delta
NCBP2 pro-265 Recombinant Human Nuclear Cap Binding Protein Subunit 2
NCEH1 pro-1393 Recombinant Human Neutral Cholesterol Ester Hydrolase 1
NCF1 pro-488 Recombinant Human Neutrophil Cytosolic Factor 1
NCF4 pro-1258 Recombinant Human Neutrophil Cytosolic Factor 4
NCK1 pro-839 Recombinant Human NCK Adaptor Protein 1
NCS1 pro-802 Recombinant Human Neuronal Calcium Sensor 1
NDE1 pro-204 Recombinant Human nudE Nuclear Distribution Gene E Homolog 1
NDRG1 pro-724 Recombinant Human N-Myc Downstream Regulated 1
NDRG2 pro-1198 Recombinant Human N-Myc Downstream Regulated 2
NECAP2 pro-180 Recombinant Human NECAP Endocytosis Associated 2
NFKBIA pro-960 Recombinant Human NF-kappa-B Inhibitor Alpha
NFKBIB pro-1046 Recombinant Human NF-kappa-B Inhibitor Beta
NHEJ1 pro-1193 Recombinant Human Nonhomologous End-Joining Factor 1
NHP2 pro-067 Recombinant Human NHP2 Ribonucleoprotein Homolog
NHP2L1 pro-038 Recombinant Human NHP2 Non-Histone Chromosome Protein 2-Like
NIP7 pro-780 Recombinant Human Nuclear Import 7 Homolog
NKIRAS1 pro-1039 Recombinant Human NFKB Inhibitor Interacting Ras-Like 1
NKIRAS2 pro-1091 Recombinant Human NFKB Inhibitor Interacting Ras-Like 2
NKp46 pro-432 Recombinant Human Natural Cytotoxicity Receptor NKp46
NKX3-1 pro-1341 Recombinant Human NK3 Homeobox 1
NME1 pro-715 Recombinant Human Non-Metastatic Cells 1
NME3 pro-082 Recombinant Human Non-Metastatic Cells 3
NME4 pro-219 Recombinant Human Non-Metastatic Cells 4
NMI pro-070 Recombinant Human N-Myc Interactor
NMM pro-366 Recombinant Human Non-Muscle Myosin-II Regulatory Light Chain
NMRAL1 pro-1131 Recombinant Human NmrA-Like Family Domain Containing 1
NOL3 pro-1178 Recombinant Human Nucleolar Protein 3
NOP16 pro-1340 Recombinant Human NOP16
NPM1 pro-1120 Recombinant Human Nucleophosmin
NPM2 pro-1182 Recombinant Human Nucleophosmin 2
NR1H2 pro-869 Recombinant Human Nuclear Receptor Subfamily 1 Group H, Member 2
NRAS pro-794 Recombinant Human Neuroblastoma RAS Viral Oncogene Homolog
NRIP3 pro-1384 Recombinant Human Nuclear Receptor-Interacting Protein 3
NTAL pro-827 Recombinant Human Non-T-cell Activation Linker
NTS pro-1311 Recombinant Human Neurotensin
NUCB2 pro-492 Recombinant Human Nucleobindin-2
NUCB2, His pro-142 Recombinant Human Nucleobindin-2, His Tag
mNUCB2 pro-605 Recombinant Mouse Nucleobindin-2
NUP210 pro-109 Recombinant Human Nucleopurin 210kDa
NUP62 pro-999 Recombinant Human Nucleopurin 62kDa
NusA pro-623 Recombinant E.Coli Transcription Termination/Antitermination L Factor
NUTF2 pro-844 Recombinant Human Nuclear Transport Factor 2
NXT1 pro-218 Recombinant Human NTF2-like Export Factor 1
NXT2 pro-1051 Recombinant Human NTF2-like Export Factor 2
NY-ESO-1 pro-531 Recombinant Human New York Esophageal Squamous Cell Carcinoma
OAZ1 pro-1200 Recombinant Human Ornithine Decarboxylase Antizyme 1
OBFC1 pro-028 Recombinant Human Oligonucleotide Binding Fold Containing 1
OCM pro-143 Recombinant Human Oncomodulin-1
OLR1 pro-923 Recombinant Human Oxidized Low Density Lipoprotein Receptor 1
OMP pro-1412 Recombinant Human Olfactory Marker Protein
Omp Pylori pro-369 Recombinant Helicobacter Pylori Outer Membrane Protein
OmpA pro-571 Recombinant Bacterial Outer Membrane Protein-A
ORAOV1 pro-1092 Recombinant Human Oral Cancer Overexpressed 1
ORM1 pro-889 Recombinant Human Orosomucoid 1
Osteocrin pro-420 Recombinant Human Osteocrin
OTUB1 pro-711 Recombinant Human Ubiquitin Aldehyde Binding 1
OTUB2 pro-214 Recombinant Human Ubiquitin Aldehyde Binding 2
OVCA2 pro-1123 Recombinant Human Ovarian Tumor Suppressor Candidate 2
p53 pro-742 Recombinant Human p53
p53 Mutant pro-301 Recombinant Human p53 Mutant
PA2G4 pro-782 Recombinant Human Proliferation-associated protein 2G4
PAEP pro-1397 Recombinant Human Progesterone-Associated Endometrial Protein
PAIP2 pro-748 Recombinant Human Polyadenylate-Binding Protein-Interacting Protein 2
PARD6B pro-1307 Recombinant Human Par-6 Partitioning Defective 6 Homolog Beta
PARK7 pro-575 Recombinant Human Parkinson Disease Protein 7
PARVA pro-1257 Recombinant Human Parvin Alpha
PBLD pro-010 Recombinant Human Phenazine Biosynthesis-Like Protein Domain Containing
pCD163 pro-856 Recombinant Porcine CD163
PCNA pro-615 Recombinant Human Proliferating Cell Antigen
PCNA GST pro-741 Recombinant Human Proliferating Cell Antigen, GST Tag
PCNA Sf9 pro-303 Recombinant Human Proliferating Cell Antigen, S9
PCNP pro-906 Recombinant Human PEST proteolytic Signal Containing Nuclear Protein
PDAP1 pro-490 Recombinant Human PDGFA Associated Protein 1
PDCD4 pro-606 Recombinant Human ProgrammedCell Death 4
PDCD5 pro-624 Recombinant Human Programmed Cell Death 5
PDCD6 pro-184 Recombinant Human Programmed Cell Death 6
PDCD6IP pro-792 Recombinant Human ProgrammedCell Death 6 Interacting Protein
PDCL pro-1141 Recombinant Human Phosducin-Like
PDCL3 pro-1028 Recombinant Human Phosducin-Like 3
PDPN pro-626 Recombinant Human Podoplanin
PDRG1 pro-007 Recombinant Human p53 and DNA-Damage Regulated 1
PDZD11 pro-1263 Recombinant Human PDZ Domain Containing 11
PEA15 pro-729 Recombinant Human Phosphoprotein Enriched in Astrocytes 15
PEBP1 pro-722 Recombinant Human Phosphatidylethanolamine Binding Protein 1
PEF1 pro-099 Recombinant Human Penta-EF-Hand Domain Containing 1
PEX pro-360 Recombinant Human C-terminal hemopexin-like domain of MMP-2 (445-635 a.a.)
PEX19 pro-925 Recombinant Human Peroxisomal Biogenesis Factor 19
PFDN1 pro-277 Recombinant Human Prefoldin Subunit 1
PFDN2 pro-001 Recombinant Human Prefoldin Subunit 2
PFDN4 pro-092 Recombinant Human Prefoldin Subunit 4
PFDN5 pro-901 Recombinant Human Prefoldin Subunit 5
PFDN6 pro-178 Recombinant Human Prefoldin Subunit 6
PFN1 pro-528 Recombinant Human Profilin-1
PFN2 pro-809 Recombinant Human Profilin-2
PFN4 pro-818 Recombinant Human Profilin-4
PGP9.5 pro-576 Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase L1
PGP9.5 GST pro-304 Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase L1 GST tag
PGR pro-535 Recombinant Human Progesterone Receptor
PHB pro-1381 Recombinant Human Prohibitin
PHF11 pro-1268 Recombinant Human PHD Finger Protein 11
PHLDA2 pro-781 Recombinant Human Pleckstrin Homology-Like Domain Family A Member 2
PIM1 pro-1389 Recombinant Human PIM1
PINX1 pro-693 Recombinant Human PIN2-Interacting Protein 1
PIR pro-1040 Recombinant Human Pirin
PITPNA pro-044 Recombinant Human Phosphatidylinositol Transfer Protein, Alpha
PITPNB pro-003 Recombinant Human Phosphatidylinositol Transfer Protein, Beta
PLDN pro-1068 Recombinant Human Pallidin Homolog
PLSCR1 pro-1271 Recombinant Human Phospholipid Scramblase 1
PMP2 pro-651 Recombinant Human Peripheral Myelin Protein-2
PMP2 His pro-671 Recombinant Human Peripheral Myelin Protein-2, His Tag
POLR2J pro-1260 Recombinant Human Polymerase (RNA) III (DNA directed) Polypeptide J
POLR3H pro-1250 Recombinant Human Polymerase (RNA) III (DNA directed) Polypeptide H
POMC pro-236 Recombinant Human Proopiomelanocortin
POP4 pro-1407 Recombinant Human Processing Of Precursor 4
POU2AF1 pro-880 Recombinant Human POU class 2 associating factor 1
POU5F1 pro-088 Recombinant Human POU Class 5 Homeobox 1
POU5F1 PolyR pro-091 Recombinant Human POU Class 5 Homeobox 1 Polyarginine-Tag
PQBP1 pro-1101 Recombinant Human Polyglutamine Binding Protein 1
Prealbumin pro-771 Recombinant Human Transthyretin
Prelamin-A pro-689 Recombinant Prelamin-A
PRND pro-018 Recombinant Human Prion Protein 2
PRNP pro-1400 Recombinant Human Prion Protein
PROC pro-485 Recombinant Human Protein-c
Protein-A/G pro-646 Recombinant Protein A/G
Protein-G pro-402 Recombinant Protein G
Protein-G His pro-1237 Recombinant Protein G His Tag
Prothrombin pro-439 Human Prothrombin Complex
P-Selectin pro-382 Recombinant Human P-Selectin
PSMA pro-740 Recombinant Human Prostate Specific Membrane Antigen
PSMB10 pro-931 Recombinant Human Proteasome Beta Type 10
PSME1 pro-266 Recombinant Human Proteasome Activator Subunit 1
PSME2 pro-975 Recombinant Human Proteasome Activator Subunit 2
PSME3 pro-987 Recombinant Human Proteasome Activator Subunit 3
PSMG2 pro-930 Recombinant Human Proteasome Assembly Chaperone 2
PSMG3 pro-261 Recombinant Human Proteasome Assembly Chaperone 3
PSMG4 pro-989 Recombinant Human Proteasome Assembly Chaperone 4
PSP94 pro-598 Recombinant Human Beta-Microseminoprotein
PTEN pro-305 Recombinant Human Phosphatase and Tensin Homolog
PTEN His pro-712 Recombinant Human Phosphatase and Tensin homolog His Tag
PTGDS pro-316 Recombinant Human Beta-Trace
pThrombin pro-617 Porcine Thrombin
pTrypsin pro-787 Recombinant Porcine Trypsin
PTTG1 pro-717 Recombinant Human Pituitary Tumor-Transforming Protein 1
PTX3 pro-694 Recombinant Human Pentraxin-3
PVALB pro-004 Recombinant Human Parvalbumin
RAB10 pro-1361 Recombinant Human RAB10, Member RAS Oncogene Family
RAB11A pro-826 Recombinant Human RAB11A, Member RAS Oncogene Family
RAB13 pro-882 Recombinant Human RAB13, Member RAS Oncogene Family
RAB14 pro-873 Recombinant Human RAB14, Member RAS Oncogene Family
RAB17 pro-874 Recombinant Human RAB17, Member RAS Oncogene Family
RAB18 pro-976 Recombinant Human RAB18, Member RAS Oncogene Family
RAB1A pro-097 Recombinant Human RAB1A, Member RAS Oncogene Family
RAB1B pro-045 Recombinant Human RAB1B, Member RAS Oncogene Family
RAB21 pro-101 Recombinant Human RAB21, Member RAS Oncogene Family
RAB22A pro-929 Recombinant Human RAB22, Member RAS Oncogene Family
RAB23 pro-977 Recombinant Human RAB23, Member RAS Oncogene Family
RAB24 pro-951 Recombinant Human RAB24, Member RAS Oncogene Family
RAB27A pro-825 Recombinant Human RAB27A, Member RAS Oncogene Family
RAB27B pro-075 Recombinant Human RAB27B, Member RAS Oncogene Family
RAB2A pro-244 Recombinant Human RAB2A, Member RAS Oncogene Family
RAB2B pro-1013 Recombinant Human RAB2B, Member RAS Oncogene Family
RAB31 pro-1090 Recombinant Human RAB31, Member RAS Oncogene Family
RAB32 pro-950 Recombinant Human RAB32, Member RAS Oncogene Family
RAB34 pro-978 Recombinant Human RAB34, Member RAS Oncogene Family
RAB35 pro-935 Recombinant Human RAB35, Member RAS Oncogene Family
RAB3A pro-870 Recombinant Human RAB3A, Member RAS Oncogene Family
RAB3B pro-875 Recombinant Human RAB3B, Member RAS Oncogene Family
RAB3D pro-247 Recombinant Human RAB3D, Member RAS Oncogene Family
RAB4A pro-871 Recombinant Human RAB4A, Member RAS Oncogene Family
RAB5A pro-590 Recombinant Human RAB5A, Member RAS Oncogene Family
RAB5B pro-056 Recombinant Human RAB5B, Member RAS Oncogene Family
RAB6A pro-047 Recombinant Human RAB6A, Member RAS Oncogene Family
RAB6B pro-103 Recombinant Human RAB6B, Member RAS Oncogene Family
RAB7A pro-077 Recombinant Human RAB7A, Member RAS Oncogene Family
RABIF pro-300 Recombinant Human RAB Interacting Factor
RAC1 pro-572 Recombinant Human Ras-Related C3 Botulinum Toxin substrate 1
RAC1 His pro-731 Recombinant Human Ras-Related C3 Botulinum Toxin substrate 1 His Tag
RAC2 pro-619 Recombinant Human Ras-Related C3 Botulinum Toxin Substrate 2
RAC2 (189) pro-719 Recombinant Human Ras-Related C3 Botulinum Toxin Substrate 2 (1-189)
RAC3 pro-073 Recombinant Human Ras-Related C3 Botulinum Toxin Substrate 3
RAD1 pro-868 Recombinant Human RAD1
RAET1E pro-1293 Recombinant Human Retinoic Acid Early Transcript 1E
RALA pro-043 Recombinant Human V-ral Simian Leukemia Viral Oncogene Homolog A
RALB pro-053 Recombinant Human V-ral Simian Leukemia Viral Oncogene Homolog B
RAMP3 pro-1367 Recombinant Human Receptor Activity-Modifying Protein 3
RAN pro-841 Recombinant Human RAN, Member RAS Oncogene Family
RANBP1 pro-1064 Recombinant Human RAN Binding Protein 1
RANGRF pro-1149 Recombinant Human RAN Guanine Nucleotide Release Factor
RAP1A pro-848 Recombinant Human RAP1A, Member RAS Oncogene Family
RAP1B pro-083 Recombinant Human RAP1B, Member RAS Oncogene Family
RAP2B pro-1364 Recombinant Human RAP2B, Member RAS Oncogene Family
RAP2A pro-061 Recombinant Human RAP2A, Member RAS Oncogene Family
RARA pro-596 Recombinant Retnoid Acid Receptor Alpha
RARRES2 pro-788 Recombinant Human Retinoic Acid Receptor Responder 2
RASSF1A pro-1288 Recombinant Human Ras association domain-containing protein 1
RASSF3 pro-1378 Recombinant Human Ras Association Domain-Containing Protein 3
RB1 pro-584 Recombinant Human Retinoblastoma Associated Protein
RBBP4 pro-1168 Recombinant Human Retinoblastoma Binding Protein 4
RBBP9 pro-991 Recombinant Human Retinoblastoma Binding Protein 9
RBM8A pro-186 Recombinant Human RNA Binding Motif Protein 8A
rCALB1 pro-400 Recombinant Rat Calbindin-1
RCAN1 pro-319 Recombinant Human Regulator of Calcineurin 1
RCAN2 pro-990 Recombinant Human Regulator of Calcineurin 2
RCAN3 pro-1284 Recombinant Human Regulator of Calcineurin 3
RCN1 pro-544 Recombinant Human Reticulocalbin 1
RCN2 pro-189 Recombinant Human Reticulocalbin 2
RCN3 pro-1049 Recombinant Human Reticulocalbin 3
RCVRN pro-441 Recombinant Human Recoverin
RDBP pro-181 Recombinant Human RD RNA Binding Protein
REG1A pro-289 Recombinant Human Regenerating Islet-Derived 1 Alpha
REG1B pro-391 Recombinant Human Regenerating Islet-Derived 1 Beta
REG3A pro-421 Recombinant Human Regenerating Islet-Derived 3 Alpha
REG4 pro-424 Recombinant Human Regenerating Islet-Derived 4
RERG pro-106 Recombinant Human RAS-like, Estrogen-Regulated, Growth Inhibitor
rFibronectin pro-131 Rat Fibronectin
rGFP pro-687 Recombinant Green Fluorescent Protein
RGN pro-915 Recombinant Human Regucalcin
RGS1 pro-1118 Recombinant Human Regulator of G-Protein Signaling 1
RGS10 pro-890 Recombinant Human Regulator of G-Protein Signaling 10
RGS14 pro-1151 Recombinant Human Regulator of G-Protein Signaling 14
RGS16 pro-798 Recombinant Human Regulator of G-Protein Signaling 16
RGS17 pro-924 Recombinant Human Regulator of G-Protein Signaling 17
RGS19 pro-037 Recombinant Human Regulator of G-Protein Signaling 19
RGS2 pro-182 Recombinant Human Regulator of G-Protein Signaling 2
RGS21 pro-898 Recombinant Human Regulator of G-Protein Signaling 21
RGS4 pro-900 Recombinant Human Regulator of G-Protein Signaling 4
RGS5 pro-905 Recombinant Human Regulator of G-Protein Signaling 5
RHEB pro-308 Recombinant Human Ras Homolog Enriched in Brain
RHOA pro-057 Recombinant Human Ras Homolog Gene Family Member A
RHOB pro-224 Recombinant Human Ras Homolog Gene Family Member B
RHOC pro-865 Recombinant Human Ras Homolog Gene Family Member C
RHOD pro-190 Recombinant Human Ras Homolog Gene Family Member D
RHOG pro-1136 Recombinant Human Ras Homolog Gene Family Member G
RHOV pro-1199 Recombinant Human Ras Homolog Gene Family Member V
rHSA HEK pro-967 Recombinant Human Serum Albumin, HEK
rHSA Plant pro-595 Recombinant Human Serum Albumin, Plant
RLN2 pro-1327 Recombinant Human Relaxin-2
rmS100b pro-1236 Recombinant Rhesus Macaque S100 Calcium Binding Protein B
RND1 pro-893 Recombinant Human Rho Family GTPase 1
RND3 pro-487 Recombinant Human Rho Family GTPase 3
RNF181 pro-1218 Recombinant Human Ring Finger Protein 181
RNF4 pro-1255 Recombinant Human Ring Finger Protein 4
ROBLD3 pro-050 Recombinant Human Roadblock Domain Containing 3
RORC pro-206 Recombinant Human RAR-Related Orphan Receptor C
RP9 pro-1314 Recombinant Human Retinitis Pigmentosa 9
RPA2 pro-011 Recombinant Human Replication Protein A2
RPL26L1 pro-1242 Recombinant Human Ribosomal Protein L26-Like 1
RPL8 pro-1053 Recombinant Human Ribosomal Protein L8
RPLP0 pro-392 Recombinant Human Ribosomal Phosphoprotein P0
RPLP1 pro-127 Recombinant Human Ribosomal Phosphoprotein P1
RPLP2 pro-128 Recombinant Human Ribosomal Phosphoprotein P2
RPS3 pro-954 Recombinant Human Ribosomal Protein S3
RPS3A pro-1125 Recombinant Human Ribosomal Protein S3A
RPS5 pro-1300 Recombinant Human Ribosomal Protein S5
RPS7 pro-993 Recombinant Human Ribosomal Protein S7
RPS10 pro-1409 Recombinant Human Ribosomal Protein S10
RPS14 pro-118 Recombinant Human Ribosomal Protein S14
rPVALB pro-398 Recombinant Rat Parvalbumin
RQCD1 pro-008 Recombinant Human RCD1 Required for Cell Differentiation1
RRAGC pro-1050 Recombinant Human Ras-Related GTP Binding C
rRAP pro-352 Recombinant Rat Receptor Associated Protein
RRAS pro-808 Recombinant Human Related RAS Viral (r-ras) Oncogene Homolog
RRAS2 pro-728 Recombinant Human Related RAS Viral (r-ras) Oncogene Homolog 2
rSCGN pro-657 Recombinant Rat Secretagogin
RSG1 pro-1334 Recombinant Human REM2 and RAB-Like Small GTPase 1
RTN4IP1 pro-1014 Recombinant Human Reticulon 4 Interacting Protein 1
rTpc1808 pro-587 Recombinant Rat Tropic 1808
rTroponin-C pro-323 Rabbit Skeletal Muscle Troponin-C
RUNX3 pro-836 Recombinant Human Runt-Related Transcription Factor 3
RUVBL1 pro-861 Recombinant Human RuvB-Like 1
rVCAM1 pro-361 Recombinant Rabbit Vascular cell adhesion molecule 1
RWDD1 pro-1309 Recombinant Human RWD Domain Containing 1
RXRA pro-437 Recombinant Human Retinoid X Receptor Alpha
RYBP pro-1139 Recombinant Human RING1 & YY1 Binding Protein
S100A1 pro-364 Recombinant Human S100 Calcium Binding Protein A1
mS100A1 pro-237 Recombinant Mouse S100 Calcium Binding Protein A1
S100A10 pro-384 Recombinant Human S100 Calcium Binding Protein A10
S100A11 pro-385 Recombinant Human S100 Calcium Binding Protein A11
S100A12 pro-152 Recombinant Human S100 Calcium Binding Protein A12
S100A13 pro-153 Recombinant Human S100 Calcium Binding Protein A13
S100A14 pro-154 Recombinant Human S100 Calcium Binding Protein A14
S100A16 pro-155 Recombinant Human S100 Calcium Binding Protein A16
S100A2 pro-146 Recombinant Human S100 Calcium Binding Protein A2
S100A3 pro-755 Recombinant Human S100 Calcium Binding Protein A3
mS100A3 pro-1166 Recombinant Mouse S100 Calcium Binding Protein A3
S100A4 pro-307 Recombinant Human S100 Calcium Binding Protein A4
S100A4 His pro-698 Recombinant Human S100 Calcium Binding Protein A4 His Tag
mS100A4 pro-229 Recombinant Mouse S100 Calcium Binding Protein A4
S100A5 pro-147 Recombinant Human S100 Calcium Binding Protein A5
mS100A5 pro-1084 Recombinant Mouse S100 Calcium Binding Protein A5
S100A6 pro-148 Recombinant Human S100 Calcium Binding Protein A6
mS100A6 pro-409 Mouse S100 Calcium Binding Protein A6
mS100A6 pro-240 Recombinant Mouse S100 Calcium Binding Protein A6
S100A7 pro-149 Recombinant Human S100 Calcium Binding Protein A7
S100A7A pro-756 Recombinant Human S100 Calcium Binding Protein A7A
S100A8 pro-800 Recombinant Human S100 Calcium Binding Protein A8
S100A8, His pro-150 Recombinant Human S100 Calcium Binding Protein A8, His Tag
mS100A8 pro-233 Recombinant Mouse S100 Calcium Binding Protein A8
S100A9 pro-814 Recombinant Human S100 Calcium Binding Protein A9
S100A9, His pro-151 Recombinant Human S100 Calcium Binding Protein A9, His Tag
mS100A9 pro-878 Recombinant Mouse S100 Calcium Binding Protein A9
S100b pro-306 Recombinant Human S100 Calcium Binding Protein B
mS100b pro-853 Recombinant Mouse S100 Calcium Binding Protein B
S100b GST pro-737 Recombinant Human S100 Calcium Binding Protein B, GST Tag
S100G pro-399 Recombinant Rat S100 Calcium Binding Protein G
S100G pro-156 Recombinant Human S100 Calcium Binding Protein G
S100P pro-425 Recombinant Human S100 Calcium Binding Protein P
S100P His pro-830 Recombinant Human S100 Calcium Binding Protein P, His Tag
S100Z pro-840 Recombinant HumanS100 Calcium Binding Protein Z
mS100A15 pro-1145 Recombinant Mouse S100 Calcium Binding Protein A15
SAMD13 pro-355 Recombinant Human Sterile Alpha Motif Domain Containing 13
SAP18 pro-707 Recombinant Human Sin3A-Associated Protein, 18kDa
SAR1A pro-709 Recombinant Human GTP-Binding Protein SAR1A
SAR1B pro-310 Recombinant Human GTP-Binding Protein SAR1B
SBDS pro-272 Recombinant Human Shwachman-Bodian-Diamond Syndrome
SCAND1 pro-269 Recombinant Human SCAN domain containing 1
SCG5 pro-467 Recombinant Human Secretogranin V
SCGB2A2 pro-515 Recombinant Human Mammaglobin-A
SCGN pro-599 Recombinant Human Secretagogin
SCO2 pro-054 Recombinant Human SCO Cytochrome Oxidase Deficient Homolog 2
SDC1 pro-1065 Recombinant Human Syndecan-1
SDC1, GST pro-516 Recombinant Human Syndecan-1, GST tag
SDC4 pro-778 Recombinant Human Syndecan-4
SDC4, His pro-583 Recombinant Human Syndecan-4, His Tag
SDCBP pro-036 Recombinant Human Syndecan Binding Protein
SDCBP2 pro-1297 Recombinant Human Syndecan Binding Protein 2
SDHAF2 pro-593 Recombinant Human Succinate Dehydrogenase Complex Assembly Factor 2
SDR16C5 pro-1385 Recombinant Human Short Chain Dehydrogenase/Reductase Family 16C, Member 5
SEC13 pro-194 Recombinant Human SEC13
SEC22B pro-1212 Recombinant Human SEC22 Homolog B
SecB pro-697 Recombinant Protein Export Protein SecB
SEPT2 pro-255 Recombinant Human Septin-2
SEPT5 pro-879 Recombinant Human Septin-5
SEPT6 pro-949 Recombinant Human Septin-6
SEPX1 pro-260 Recombinant Human Selenoprotein X 1
SERPINA1 pro-456 Human Alpha-1 Antitrypsin
SERPINA1 pro-529 Recombinant Human Alpha-1 Antitrypsin
SERPINA1, Active pro-907 Recombinant Human Alpha-1 Antitrypsin, Active
SERPINA3 pro-750 Recombinant Human Alpha-1 AntiChymotrypsin
SERPINA3 pro-378 Human Alpha-1 AntiChymotrypsin
SERPINA5 pro-749 Recombinant Human Serpin Peptidase Inhibitor, Clade A Member 5
SERPINB5 pro-202 Recombinant Human Serpin Peptidase Inhibitor, Clade B Member 5
SERPINB5 His pro-704 Recombinant Human Serpin Peptidase Inhibitor, Clade B Member 5, His Tag
SERPING1 pro-1401 Recombinant Human Serpin Peptidase Inhibitor, Clade G Member 1
SERPINI1 pro-213 Recombinant Human Serpin Peptidase Inhibitor, Clade I Member 1
SERTAD1 pro-1157 Recombinant Human SERTA Domain Containing 1
SF3B14 pro-105 Recombinant Human Splicing Factor 3B, 14 kDa Subunit
SGCD pro-1373 Recombinant Human Sarcoglycan Delta
SGTA pro-807 Recombinant Human Small Glutamine-Rich Tetratricopeptide Repeat-Containing Protein Alpha
SH2D1A pro-006 Recombinant Human SH2 domain containing 1A
SH3BGRL pro-1159 Recombinant Human SH3 Domain Binding Glutamic Acid-Rich Protein Like
SH3BGRL2 pro-1215 Recombinant Human SH3 Domain Binding Glutamic Acid-Rich Protein Like 2
SH3BGRL3 pro-1216 Recombinant Human SH3 Domain Binding Glutamic Acid-Rich Protein Like 3
SH3GL2 pro-1083 Recombinant Human SH3-domain GRB2-like 2
SH3GLB1 pro-1278 Recombinant Human SH3-domain GRB2-like endophilin B1
SH3GLB2 pro-1287 Recombinant Human SH3-domain GRB2-like endophilin B2
SHC1 pro-883 Recombinant Human SHC-Transforming Protein 1
SIL1 pro-1187 Recombinant Human SIL1
SIRT2 pro-033 Recombinant Human SIrtuin-2
SIRT3 pro-462 Recombinant Human SIrtuin-3
SIRT6 pro-282 Recombinant Human SIrtuin-6
SIT1 pro-928 Recombinant Human Signaling Threshold Regulating Transmembrane Adaptor 1
SIX1 pro-1226 Recombinant Human SIX Homeobox 1
SIX6 pro-1253 Recombinant Human SIX Homeobox 6
SLAMF1 pro-1342 Recombinant Human SLAMF1
SLAMF6 pro-1286 Recombinant Human SLAMF6
SLC4A4 pro-688 Recombinant Human Solute Carrier Family 4, Sodium Bicarbonate Cotransporter, Member 4
SLPI pro-849 Recombinant Human Secretory Leukocyte Peptidase Inhibitor
SMAC/DIABLO pro-614 Recombinant Human SMAC/DIABLO
SMAD2 pro-691 Recombinant Human SMAD Family Member 2
SMAD3 pro-751 Recombinant Human Mothers Against Decapentaplegic Homolog 3
SMAD4 pro-459 Recombinant Human Mothers Against Decapentaplegic Homolog 4
SMNDC1 pro-035 Recombinant Human Survival Motor Neuron Domain Containing 1
SNAP23 pro-659 Recombinant Human Synaptosomal-associated protein 23kDa
SNAP25 pro-573 Recombinant Human Synaptosomal-associated protein 25kDa
SNAP-25 pro-396 Recombinant Synaptosomal-associated protein 25kDa, C.elegans
SNAP25B pro-635 Recombinant Human Synaptosomal-associated protein 25B
SNAPIN pro-663 Recombinant Human SNAP Associated Protein
SNCA pro-393 Recombinant Human Alpha-Synuclein
SNCA 1-60 pro-165 Recombinant Human Alpha-Synuclein 1-60
SNCA 61-140 pro-163 Recombinant Human Alpha-Synuclein 61-140
SNCA 96-140 pro-164 Recombinant Human Alpha-Synuclein 96-140
SNCA A30P pro-158 Recombinant Human Alpha-Synuclein A30P
SNCA A30P/A53T pro-160 Recombinant Human Alpha-Synuclein A30P/A53T
SNCA A53T pro-159 Recombinant Human Alpha-Synuclein A53T
SNCA Delta-NAC pro-161 Recombinant Human Alpha-Synuclein Delta-NAC
SNCA NACP112 pro-162 Recombinant Human Alpha-Synuclein NACP112
CA pro-858 Recombinant Mouse Alpha-Synuclein
SNCB pro-394 Recombinant Human Beta-Synuclein
SNCG pro-395 Recombinant Human Gamma-Synuclein
SNF8 pro-1135 Recombinant Human SNF8, ESCRT-II Complex Subunit
SNIP1 pro-201 Recombinant Human Smad Nuclear Interacting Protein 1
SNPH pro-545 Recombinant Human Syntaphilin
SNRNP25 pro-226 Recombinant Human Small Nuclear Ribonucleoprotein 25kDa
SNRNP70 pro-445 Recombinant Human Small Nuclear Ribonucleoprotein 70kDa
SNRPA1 pro-1015 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide A
SNRPB2 pro-217 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide B
SNRPC pro-1004 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide C
SNRPD pro-997 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D1, D2, D3
SNRPD1 pro-994 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D1
SNRPD2 pro-123 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D2
SNRPD2, Sf9 pro-995 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D2, Sf9
SNRPD3 pro-945 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D3
SNRPD3, Sf9 pro-996 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D3, Sf9
SNRPE pro-104 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide E
SNRPF pro-041 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide F
SNRPG pro-196 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide G
SNTA1 pro-1016 Recombinant Human Syntrophin, Alpha 1
SNTN pro-216 Recombinant Human Sentan Cilia Apical Structure Protein
SNUPN pro-866 Recombinant Human Snurportin 1
SNX1 pro-665 Recombinant Human Sorting Nexin 1
SNX3 pro-246 Recombinant Human Sorting Nexin 3
SOD pro-286 Recombinant Human Superoxide Dismutase
SOD His pro-1239 Recombinant Human Superoxide Dismutase His Tag
SOD1 pro-648 Recombinant Human Superoxide Dismutase-1
SOD2 pro-819 Recombinant Human Superoxide Dismutase-2
SODA pro-208 Recombinant E.Coli Superoxide Dismutase
SOSTDC1 pro-426 Recombinant Human Sclerostin Domain Containing 1
SOX2 pro-820 Recombinant Human SRY (sex determining region Y)-box 2
SOX2 PolyR pro-089 Recombinant Human SRY (sex determining region Y)-box 2 Polyarginine-Tag
Sox2-TAT pro-1343 Recombinant Human SRY (sex determining region Y)-box 2 TAT
SOX9 pro-739 Recombinant Human SOX9
SP100 pro-108 Recombinant Human SP100
SPA pro-356 Recombinant Staphylococcal Protein-A
SPA 41kDa pro-774 Recombinant Staphylococcal Protein-A 41kDa
SPA 434a.a. pro-686 Recombinant Staphylococcal Protein A 434 a.a
SPARC pro-582 Recombinant Human Secreted Protein Acidic & Rich in Cysteine
SPG21 pro-677 Recombinant Human Spastic Paraplegia 21
SPIN1 pro-1184 Recombinant Human Spindlin-1
SPINT pro-1296 Recombinant Human Serine Peptidase Inhibitor, Kunitz Type 2
SPOP pro-195 Recombinant Human Speckle-Type POZ Protein
SPSB1 pro-223 Recombinant Human SPRY Domain-Containing SOCS Cox Protein 1
SPSB2 pro-1264 Recombinant Human SPRY Domain-Containing SOCS Cox Protein 2
SQSTM1 pro-806 Recombinant Human Sequestosome 1
SRA1 pro-1274 Recombinant Human Steroid Receptor RNA Activator 1
sRAGE pro-600 Recombinant Human Advanced Glycosylation End Product-Specific Receptor
sRAGE HEK pro-601 Recombinant Human Advanced Glycosylation End Product-Specific Receptor, HEK
SRSF1 pro-1352 Recombinant Human Serine/arginine-Rich Splicing Factor 1
SRGN pro-965 Recombinant Human Serglycin
SRI pro-166 Recombinant Human Sorcin
SRP14 pro-013 Recombinant Human Signal Recognition Particle 14kDa
SRP54 pro-113 Recombinant Human Signal Recognition Particle 54kDa
SSBP1 pro-1408 Recombinant Human Single-Stranded DNA Binding Protein 1
SSR2 pro-1380 Recombinant Human Signal Sequence Receptor, Beta
SSR4 pro-1294 Recombinant Human Signal Sequence Receptor, Delta
SSX1 pro-1379 Recombinant Human Synovial Sarcoma, X Breakpoint 1
STAMBP pro-017 Recombinant Human STAM Binding Protein
STAMBPL1 pro-1354 Recombinant Human STAM Binding Protein Like 1
STAP1 pro-1110 Recombinant Human Signal Transducing Adaptor Family Member 1
STAR pro-979 Recombinant Human Steroidogenic Acute Regulatory Protein
STIM1 pro-620 Recombinant Human Stromal Interaction Molecule 1
STIP1 pro-753 Recombinant Human Stress-Induced-Phosphoprotein 1
STMN1 pro-676 Recombinant Human Stathmin-1
STMN2 pro-752 Recombinant Human Stathmin Like-2
STMN3 pro-838 Recombinant Human Stathmin Like-3
Streptavidin pro-283 Streptavidin
Streptavidin pro-791 Recombinant Streptavidin
Streptavidin, His pro-621 Recombinant Streptavidin, His Tag
Streptavidin-NC pro-338 Recombinant Streptavidin-NC
STX11 pro-1111 Recombinant Human Syntaxin-11
STX12 pro-1099 Recombinant Human Syntaxin-12
STX1A pro-574 Recombinant Human Syntaxin-1A
STX2 pro-1146 Recombinant Human Syntaxin-2
STX3 pro-1082 Recombinant Human Syntaxin-3
STX4 pro-1176 Recombinant Human Syntaxin-4
SUB1 pro-835 Recombinant Human SUB1 Homolog
SUFU pro-938 Recombinant Human Suppressor of Fused Homolog
SUGT1 pro-096 Recombinant Human SGT1
SUMF1 pro-986 Recombinant Human Sulfatase Modifying Factor 1
SUMO1 pro-326 Recombinant Human Small Ubiquitin-Related Modifier 1
SUMO1 His pro-980 Recombinant Human Small Ubiquitin-Related Modifier 1, His Tag
SUMO2 pro-586 Recombinant Human Small Ubiquitin-Related Modifier 2
SUMO2 GST pro-541 Recombinant Human Small Ubiquitin-Related Modifier 2, GST
SUMO3 pro-267 Recombinant Human Small Ubiquitin-Related Modifier 3
SURF1 pro-764 Recombinant Human Surfeit-1
SYCE3 pro-1179 Recombinant Human Synaptonemal Complex Central Element Protein 3
SYF2 pro-969 Recombinant Human SYF2 RNA splicing factor
SYT1 pro-239 Recombinant Human Synaptotagmin I
SYT4 pro-1375 Recombinant Human Synaptotagmin IV
TAC1 pro-1338 Recombinant Human Tachykinin-1
TAC3 pro-716 Recombinant Human Tachykinin-3
TACSTD2 pro-157 Recombinant Human Tumor-Associated Calcium Signal Transducer 2
TAGLN pro-851 Recombinant Human Transgelin
TAGLN2 pro-124 Recombinant Human Transgelin-2
TAGLN3 pro-946 Recombinant Human Transgelin-3
TANK pro-1348 Recombinant Human TRAF Family Member-Associated NFKB Activator
TARDBP pro-1410 Recombinant Human TAR DNA Binding Protein
TAX1BP3 pro-981 Recombinant Human Tax1 Binding Protein 3
TBCA pro-705 Recombinant Human Tubulin Folding Cofactor A
TBCB pro-1127 Recombinant Human Tubulin Folding Cofactor B
TBCC pro-1180 Recombinant Human Tubulin Folding Cofactor C
TBPL1 pro-736 Recombinant Human TBP-Like 1
TBCEL pro-030 Recombinant Human Tubulin Folding Cofactor E-Like
TCEA1 pro-1098 Recombinant Human Transcription Elongation Factor A (SII)- 1
TCEAL1 pro-507 Recombinant Human Transcription Elongation Factor A (SII)-Like 1
TCEAL3 pro-1128 Recombinant Human Transcription Elongation Factor A (SII)-Like 3
TCEAL7 pro-1147 Recombinant Human Transcription Elongation Factor A (SII)-Like 7
TCEAL8 pro-1188 Recombinant Human Transcription Elongation Factor A (SII)-Like 8
TCEB1 pro-1017 Recombinant Human Transcription Elongation Factor B Polypeptide 1
TCEB2 pro-664 Recombinant Human Transcription Elongation Factor B Polypeptide 2
TCL1A pro-726 Recombinant Human T-cell Leukemia/Lymphoma 1A
TCP1 pro-276 Recombinant Human T-Complex 1
TES pro-549 Recombinant Human Testis Derived Transcript
TEV pro-585 Recombinant Tobacco Etch Virus Protease
TFAM pro-095 Recombinant Human Transcription Factor-A
TFB1M pro-903 Recombinant Human Transcription Factor B1, Mitochondrial
TFB2M pro-1259 Recombinant Human Transcription Factor B2, Mitochondrial
TFPI2 pro-860 Recombinant Human Tissue Factor Pathway Inhibitor 2
TGFBI pro-568 Recombinant Human Transforming Growth Factor Beta Induced
TGFBI 182 pro-672 Recombinant Human Transforming Growth Factor Beta Induced 182 a.a.
THAP1 pro-1089 Recombinant Human THAP Domain Containing, Apoptosis Associated Protein 1
THBS1 pro-288 Recombinant Human Thrombospondin
Thrombin pro-339 Human Thrombin
THYN1 pro-270 Recombinant Human Thymocyte Nuclear Protein 1
Thyroglobulin pro-443 Human Thyroglobulin
TIAF1 pro-1211 Recombinant Human TGFB1-Induced Anti-Apoptotic Factor 1
TICAM2 pro-1036 Recombinant Human Toll-Like Receptor Adaptor Molecule 2
TIFA pro-1041 Recombiant Human TRAF-Interacting Protein with Forkhead-Associated Domain
TIRAP pro-1181 Recombinant Human Toll-Interleukin 1 Receptor (TIR) Domain Containing Adaptor Protein
TMOD3 pro-1165 Recombinant Human Tropomodulin 3
TNIP1 pro-005 Recombinant Human TNFAIP3 Interacting Protein 1
TNNI1 pro-1269 Recombinant Human Troponin I Type 1
TNNI2 pro-1283 Recombinant Human Troponin I Type 2
TNNT2 pro-703 Recombinant Human Troponin T Type 2, Cardiac Isoform 3
TOLLIP pro-228 Recombinant Human Toll Interacting Protein
TPD52L1 pro-442 Recombinant Human Tumor Protein D52 L1
TPM1 pro-469 Recombinant Human Tropomyosin-1
TPM2 pro-069 Recombinant Human Tropomyosin-2
TPM3 pro-1020 Recombinant Human Tropomyosin-3
TPM4 pro-187 Recombinant Human Tropomyosin-4
TPRKB pro-1185 Recombinant Human TP53RK Binding Protein
TPT1 pro-776 Recombinant Human Tumor Protein Translationally-Controlled 1
TRAF1 pro-834 Recombinant Human TNF receptor-Associated Factor 1
TRAF2 pro-685 Recombinant Human TNF receptor-Associated Factor 2
Transferrin pro-747 Recombinant Human Transferrin
TRAPPC2 pro-1272 Recombinant Human Trafficking Protein Particle Complex 2
TRAPPC3 pro-1056 Recombinant Human Trafficking Protein Particle Complex 3
TRAPPC4 pro-1273 Recombinant Human Trafficking Protein Particle Complex 4
TREM1 pro-457 Recombinant Human Triggering Receptor Expressed on Myeloid Cells 1
TRIM21 pro-328 Recombinant Human Tripartite Motif Containing 21 (RO52)
Troponin 1 pro-341 Recombinant Human fast skeletal Troponin 1
Troponin I-C pro-344 Recombinant Human Cardiac Troponin I-C Complex
Troponin I-C pro-345 Recombinant Single Chain Cardiac Troponin I-C
Troponin I-C pro-346 Recombinant Single Chain Cardiac Troponin I-C 2nd generation
Troponin-C pro-322 Recombinant Human Cardiac Troponin-C
Troponin-C His pro-959 Recombinant Human Cardiac Troponin-C His
Troponin-I pro-324 Recombinant Human Cardiac Troponin-I
Troponin-T pro-342 Human Cardiac Troponin-T
TROVE2 pro-329 Recombinant Human TROVE Domain Family Member 2
TROVE2 His pro-110 Recombinant Human TROVE Domain Family Member 2 His Tag
Trypsin pro-770 Recombinant Human Trypsin
Trypsin Yeast pro-786 Recombinant Human Trypsin, Yeast
TSC22D3 pro-1254 Recombinant Human TSC22 Domain Family, Member 3
TSEN15 pro-144 Recombinant Human tRNA Splicing Endonuclease 15
TSG101 pro-805 Recombinant Human Tumor Susceptibility Gene 101
TSN pro-271 Recombinant Human Translin
TSNAX pro-1292 Recombinant Human Translin-Associated Factor X
TSSC4 pro-1021 Recombinant Human Tumor Suppressing Subtransferable Candidate 4
TTC1 pro-1160 Recombinant Human Tetratricopeptide Repeat Domain 1
TTC32 pro-1246 Recombinant Human Tetratricopeptide Repeat Domain 32
TTC33 pro-1217 Recombinant Human Tetratricopeptide Repeat Domain 33
TUBB3 pro-1388 Recombinant Human Tubulin, Beta 3 Class III
TUBG1 pro-982 Recombinant Human Tubulin Gamma 1
TULP1 pro-1191 Recombinant Human Tubby Like Protein 1
TWF1 pro-1003 Recombinant Human Twinfilin-1
TXN1 pro-334 Recombinant E.Coli Thioredoxin
TXN1 pro-569 Recombinant Human Thioredoxin
TXN1, His pro-784 Recombinant E.Coli Thioredoxin, His
TXN1, His pro-804 Recombinant Human Thioredoxin His Tag
TXN2 pro-625 Recombinant Human Thioredoxin-2
TXNDC12 pro-1133 Recombinant Human Thioredoxin Domain Containing 12
TXNDC17 pro-1055 Recombinant Human Thioredoxin Domain Containing 17
TXNL1 pro-084 Recombinant Human Thioredoxin-Like 1
TXNL4A pro-1100 Recombinant Human Thioredoxin-Like 4A
TXNL4B pro-238 Recombinant Human Thioredoxin-Like 4B
TYW5 pro-1315 Recombinant Human tRNA-yW Synthesizing Protein 5
U. Urealyticum pro-670 Recombinant Ureaplasma Urealyticum Parvum
UBD pro-927 Recombinant Human Ubiquitin-D
Ubiquitin pro-314 Recombinant Human Ubiquitin
Ubiquitin Biotin pro-629 Recombinant Human Ubiquitin Biotin
Ubiquitin G76A pro-280 Recombinant Human Ubiquitin Gly76 to Ala76 mutation
Ubiquitin GST pro-735 Recombinant Human Ubiquitin, GST Tag
Ubiquitin K48R pro-372 Recombinant Human Ubiquitin Lys 48 to Arg 48 mutation
UBL3 pro-230 Recombinant Human Ubiquitin-Like 3
UBL4A pro-1043 Recombinant Human Ubiquitin-Like 4A
UBL5 pro-231 Recombinant Human Ubiquitin-Like 5
UBTD2 pro-1203 Recombinant Human Ubiquitin Domain Containing 2
UFM1 pro-125 Recombinant Human Ubiquitin-Fold Modifier 1
UFSP1 pro-1320 Recombinant Human UFM1-Specific Peptidase 1
ULBP2 pro-1134 Recombinant Human UL16 Binding Protein 2
Ulinastatin pro-608 Recombinant Human Urinary Trypsin Inhibitor (UTI)
Ulinastatin pro-321 Human Urinary Trypsin Inhibitor (UTI)
UNC119B pro-1034 Recombinant Human UNC-119 Homolog B
UPK2 pro-479 Recombinant Human Uroplakin 2
UPK3A pro-988 Recombinant Human Uroplakin 3A
UQCRC2 pro-1224 Recombinant Human Ubiquinol-Cytochrome C Reductase Core Protein II
URM1 pro-188 Recombinant Human Ubiquitin Related Modifier 1
USH1C pro-706 Recombinant Human Usher Syndrome 1C
USP14 pro-016 Recombinant Human Ubiquitin Specific Peptidase 14
UTP23 pro-1235 Recombinant Human UTP23, Small Subunit Processome Component
UXT pro-1312 Recombinant Human Ubiquitously-Expressed, Prefoldin-Like Chaperone
VAMP1 pro-577 Recombinant Human Synaptobrevin-1
VAMP2 pro-578 Recombinant Human Synaptobrevin-2
VAMP3 pro-652 Recombinant Human Synaptobrevin-3
VAMP4 pro-714 Recombinant Human Vesicle-Associated Membrane Protein 4
VAMP5 pro-681 Recombinant Human Synaptobrevin-5
VAMP7 pro-1194 Recombinant Human Vesicle-Associated Membrane Protein 7
VAMP8 pro-660 Recombinant Human Synaptobrevin-8
VAPA pro-779 Recombinant Human VAMP Associated Protein A, 33kDa
VAPB pro-014 Recombinant Human VAMP Associated Protein B and C
VASP pro-191 Recombinant Human Vasodilator-Stimulated Phosphoprotein
VAT1 pro-1011 Recombinant Human Vesicle Amine Transport Protein 1 Homolog
VBP1 pro-1325 Recombinant Human Von Hippel-Lindau Binding Protein 1
VCAM1 pro-386 Recombinant Human Vascular cell adhesion molecule 1
VDR pro-205 Recombinant Human Vitamin D Receptor
VHL pro-440 Recombinant Human Von Hippel-Lindau Protein
Vimentin pro-309 Recombinant Human Vimentin
Vimentin GST pro-734 Recombinant Human Vimentin, GST Tag
VOPP1 pro-200 Recombinant Human Vesicular Overexpressed in Cancer, Prosurvival Protein 1
VPS24 pro-872 Recombinant Human Vacuolar Protein Sorting 24
VPS25 pro-1054 Recombinant Human Vacuolar Protein Sorting 25
VPS26A pro-1161 Recombinant Human Vacuolar Protein Sorting 26A
VPS28 pro-730 Recombinant Human Vacuolar Protein Sorting 28
VPS29 pro-1075 Recombinant Human Vacuolar Protein Sorting 29
mVPS29 pro-1066 Recombinant Mouse Vacuolar Protein Sorting 29
VRK3 pro-1130 Recombinant Human Vaccinia Related Kinase 3
VSNL1 pro-723 Recombinant Human Visinin-Like Protein-1
VSNL1 His pro-602 Recombinant Human Visinin-Like Protein-1 His Tag
VSTM2L pro-1018 Recombinant Human V-Set and Transmembrane Domain Containing 2 Like
VTA1 pro-1044 Recombinant Human Vps20-Associated 1 Homolog
VTI1B pro-1115 Recombinant Human Vesicle Transport Through Interaction with t-SNAREs Homolog 1B
WBP2 pro-1208 Recombinant Human WW Domain Binding Protein 2
WDR5 pro-863 Recombinant Human WD Repeat Domain 5
WHSC2 pro-062 Recombinant Human Wolf-Hirschhorn Syndrome Candidate 2
WIBG pro-864 Recombinant Human within BCGN Homolog
WIF1 pro-684 Recombinant Human WNT Inhibitory Factor 1
WLS pro-1402 Recombinant Human Wntless
XAGE1A pro-1256 Recombinant Human X Antigen Family, Member 1A
XG pro-1395 Recombinant Human XG Blood Group
XPA pro-026 Recombinant Human Xeroderma Pigmentosum, Complementation Group A
YEATS4 pro-1019 Recombinant Human YEATS Domain Containing 4
yTXN1 pro-333 Recombinant Yeast Thioredoxin
: