Prostatic Acid Phosphatase (248-286), PAP (248-286) peptide is a semen-derived enhancer of viral infection (SEVI) factor found in semen. This peptide greatly increases HIV infection through enhanced virion attachment to target cells.

H – Gly – Ile – His – Lys – Gln – Lys – Glu – Lys – Ser – Arg – Leu – Gln – Gly – Gly – Val – Leu – Val – Asn – Glu – Ile – Leu – Asn – His – Met – Lys – Arg – Ala – Thr – Gln – Ile – Pro – Ser – Tyr – Lys – Lys – Leu – Ile – Met – Tyr – OH

≥ 95%

-20°C

GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY