This peptide is OVA peptide residues 241 to 270. OVA Peptide is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC).

H – Ser – Met – Leu – Val – Leu – Leu – Pro – Asp – Glu – Val – Ser – Gly – Leu – Glu – Gln – Leu – Glu – Ser – Ile – Ile – Asn – Phe – Glu – Lys – Leu – Thr – Glu – Trp – Thr – Ser – OH

≥ 95%

-20°C

SMLVLLPDEVSGLEQLESIINFEKLTEWTS

Mareeva, T. et al. J Biol Chem 279, 44243 (2004).