IGFBP-3R; Transmembrane protein 219; TMEM219

Human

HEK293

60-65 kDa

Lyophilized Powder

Lyophilized from PBS, pH7.4

SFLLTHRTGLRSPDIPQDWVSFLRSFGQLTLCPRNGTVTGKWRGSHVVGLLTTLNFGDGPDRNKTRTFQATVLGSQMGLKGSSAGQLVLITARVTTERTAGTCLYFSAVPGILPSSQPPISCSEEGAGNATLSPRMGEECVSVWSHEGLVLTKLLTSEELALCGSRIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Human Fc Tag

＞95% by SDS-PAGE

<0.1EU/ug

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Within 1 week, 2 to 8 °C under sterile conditions after reconstitution. 12 months from date of receipt, -20 to -80 °C as supplied. Avoid repeated freeze-thaw cycles.

TMEM219 is a recently discovered death receptor, which induces cell apoptosis by a Caspase-8-dependent mechanism, through the binding with its ligand, the Insulin-like growth factors binding protein 3 (IGFBP3). TMEM219 consists of four exons comprising the 915-base pair cDNA sequence on chromosome 16q13 and represents a 240-amino acid polypeptide. TMEM219 is expressed on pancreatic beta cells and that signaling through its ligand insulin-like growth factor binding protein 3 (IGFBP3) leads to beta cell loss and dysfunction. TMEM219 is an IL-13Rα2 binding partner that plays a critical role in many Chi3l1-induced, IL-13Rα2-mediated cellular and organ responses.

Q86XT9-1

1. Chang-Min Lee , Chuan Hua He.IL-13Rα2 uses TMEM219 in chitinase 3-like-1- induced signalling and effector responses.Nat Commun. 2016 Sep 15;7:12752. doi: 10.1038/ncomms12752.